LXL04_037965 | RubberDandelionOmics

Gene overview

LXL04_037965

Reference: OH-1004 Chr: Chr09 Coordinates: 26959891-26964140 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1329 bp · LXL04_037965|LXL04_037965|OH1004|cDNA

ATGGAGTTCGTGAAGCAGCGAGGAAGACGACGCGAGGAAGACGACGCGAGGAGGAAGCAGCGTTTGAAGACATTTAGTCCCTATCCTTTTGCTTTCTCCGCCTCCAAACACTTCTCTACTGCCCGTGGTTCAAGATCTGTGAAATCTGATGATCAAGCTGAGAAATCTGCTTCCAAGAAAAGGAAGAACCAATACAGAGGAATCCGTCAGCGGCCATGGGGGAAATGGGCTGCCGAGATACGTGATCCAAGGAAAGGCGT...

CDS

Download CDS FASTA

1329 bp · LXL04_037965|LXL04_037965|OH1004|CDS

ATGGAGTTCGTGAAGCAGCGAGGAAGACGACGCGAGGAAGACGACGCGAGGAGGAAGCAGCGTTTGAAGACATTTAGTCCCTATCCTTTTGCTTTCTCCGCCTCCAAACACTTCTCTACTGCCCGTGGTTCAAGATCTGTGAAATCTGATGATCAAGCTGAGAAATCTGCTTCCAAGAAAAGGAAGAACCAATACAGAGGAATCCGTCAGCGGCCATGGGGGAAATGGGCTGCCGAGATACGTGATCCAAGGAAAGGCGT...

Protein

Download Protein FASTA

442 aa · LXL04_037965|LXL04_037965|OH1004|PROTEIN

MEFVKQRGRRREEDDARRKQRLKTFSPYPFAFSASKHFSTARGSRSVKSDDQAEKSASKKRKNQYRGIRQRPWGKWAAEIRDPRKGVRVWLGTFNTAEEAARAYDAEARRIRGEKAKVNFPEKSSPAKPKSQKAKPTAIAEDLPAAKPFIPSETAGFYFSSDQGSNSYDCSDFPWGETCTKTPEITSVLSEVDEANFMEDRPVKKPKTECVNLVSDCETTSDDLFFEIPYIEGNWNTSSVDAFLNEDSVYARAEKQCTQG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037965`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037965

Location Chr09:26959891-26964140 (-)

Description Similar to EREBP1: Ethylene-responsive transcription factor 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14230`	Transcription factor involved in carotenoid biosynthesis regulation.	Arabidopsis RAP2.2: an ethylene response transcription factor that is important for hypoxia survival.2010 · DOI: 10.1104/pp.110.155077
`At1g53910`	Transcription factor involved in the activation of hypoxic gene expression and in ethylene response.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0782700`	Probable transcriptional activator that may be involved in defense signaling pathway.	BWMK1, a rice mitogen-activated protein kinase, locates in the nucleus and mediates pathogenesis-related gene expression by activation of a transcription factor.2003 · DOI: 10.1104/pp.103.023176

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037965 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0046148 pigment biosynthetic process Biological Process

GO:0070483 detection of hypoxia Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G53910

ath:AT3G14230

mdm:103446446

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.927

Rank 1 · LXL04_037965 · OH-1004

Cytoplasm0.118

Rank 2 · LXL04_037965 · OH-1004

Cell membrane0.035

Rank 3 · LXL04_037965 · OH-1004

Plastid0.025

Rank 4 · LXL04_037965 · OH-1004

Endoplasmic reticulum0.024

Rank 5 · LXL04_037965 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847.27AP264-113 aa

PF00264.26Tyrosinase276-426 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037965	`PF00847.27`	AP2	64	113	2.8e-12	47.5
LXL04_037965	`PF00264.26`	Tyrosinase	276	426	1.3e-06	29.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUM4`	Arabidopsis thaliana	Ethylene-responsive transcription factor RAP2-2	41.259%	Swiss-Prot	moderate database homology
`Q9SSA8`	Arabidopsis thaliana	Ethylene-responsive transcription factor RAP2-12	43.866%	Swiss-Prot	moderate database homology
`Q6K7E6`	Oryza sativa subsp. japonica	Ethylene-responsive transcription factor 1	46.122%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card