TkA08G161330 | RubberDandelionOmics

Gene overview

TkA08G161330

Reference: TK1151 Chr: Chr08 Coordinates: 42097826-42098176 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

351 bp · TkA08G161330|TK1151|cDNA

ATGACACTAATCACTCACACACAACTCACGAAGGAAATAAAGCAAGAAGGAACACAAGGATTTTACGTGGTTCGGATTCGGTGTAAATCCTACGTCCACGGGCTGCAACTAGATTTTCTTATTAACTCAATAAGATTACAATTTGGCTCTCACACTCCAAGAGATATGTTACATTTGATGCATTTTCTCTTCTCCTGCCTTCATCTATATATATACATGGAGCTTACAAATGTCAAAGGAGTAGGTGAAAGTTGGCCAAC...

CDS

Download CDS FASTA

351 bp · TkA08G161330|TK1151|CDS

ATGACACTAATCACTCACACACAACTCACGAAGGAAATAAAGCAAGAAGGAACACAAGGATTTTACGTGGTTCGGATTCGGTGTAAATCCTACGTCCACGGGCTGCAACTAGATTTTCTTATTAACTCAATAAGATTACAATTTGGCTCTCACACTCCAAGAGATATGTTACATTTGATGCATTTTCTCTTCTCCTGCCTTCATCTATATATATACATGGAGCTTACAAATGTCAAAGGAGTAGGTGAAAGTTGGCCAAC...

Protein

Download Protein FASTA

116 aa · TkA08G161330|TK1151|PROTEIN

MTLITHTQLTKEIKQEGTQGFYVVRIRCKSYVHGLQLDFLINSIRLQFGSHTPRDMLHLMHFLFSCLHLYIYMELTNVKGVGESWPTTFELNTQFKHATQEPLYLTMFFSTNQHTI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G161330`
TK1151 ID	TkA08G161330
OH-1004 ID	LXL04_039041
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	91.900
Protein coverage (%)	TK1151 31.897 / OH-1004 9.273 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G161330`
Location	Chr08:42097826-42098176 (+)
Description	Similar to At5g49770: Probable leucine-rich repeat receptor-like protein kinase At5g49770
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_039041` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0007165 signal transduction Biological Process GO:0009593 detection of chemical stimulus Biological Process GO:0009610 response to symbiotic fungus Biological Process GO:0010228 vegetative to reproductive phase transition of meristem Biological Process GO:0046777 protein autophosphorylation Biological Process GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process GO:0048574 long-day photoperiodism, flowering Biological Process GO:0090333 regulation of stomatal closure Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference	ath:AT3G12145 ath:AT3G14350 ath:AT5G16590 ath:AT5G49760 ath:AT5G49770 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.439

Rank 1 · TkA08G161330 · TK1151

Nucleus0.386

Rank 2 · TkA08G161330 · TK1151

Mitochondrion0.174

Rank 3 · TkA08G161330 · TK1151

Cell membrane0.079

Rank 4 · TkA08G161330 · TK1151

Endoplasmic reticulum0.076

Rank 5 · TkA08G161330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19713DUF620812-31 aa

PF19713DUF620861-85 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G161330	`PF19713`	DUF6208	12	31	0.16	11.5
TkA08G161330	`PF19713`	DUF6208	61	85	0.16	11.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card