LXL04_039041 | RubberDandelionOmics

Gene overview

LXL04_039041

Reference: OH-1004 Chr: Chr09 Coordinates: 57330813-57335322 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1200 bp · LXL04_039041|LXL04_039041|OH1004|cDNA

ATGGGTTTAAGAAGTCCGCTATGGATGCTGATTGTTTGCAGTCAAGTTATGGTAATTGCAGCCGTGACGGACGGAAATGATGTTGCTGCCCTGAATGCTATGAAGTCTACGTGGAAGAATTTACCACCTAATTGGAAAGGTCCAGATCCATGTGGAACTAAATGGGACGGAATTAACTGTACAACGTCACGTGTAACCTCCTTATTCCTTGCAGGCATGGGGGTGAGAACAAACAACATTGAGGATATAACATCACTTTC...

CDS

Download CDS FASTA

1200 bp · LXL04_039041|LXL04_039041|OH1004|CDS

ATGGGTTTAAGAAGTCCGCTATGGATGCTGATTGTTTGCAGTCAAGTTATGGTAATTGCAGCCGTGACGGACGGAAATGATGTTGCTGCCCTGAATGCTATGAAGTCTACGTGGAAGAATTTACCACCTAATTGGAAAGGTCCAGATCCATGTGGAACTAAATGGGACGGAATTAACTGTACAACGTCACGTGTAACCTCCTTATTCCTTGCAGGCATGGGGGTGAGAACAAACAACATTGAGGATATAACATCACTTTC...

Protein

Download Protein FASTA

399 aa · LXL04_039041|LXL04_039041|OH1004|PROTEIN

MGLRSPLWMLIVCSQVMVIAAVTDGNDVAALNAMKSTWKNLPPNWKGPDPCGTKWDGINCTTSRVTSLFLAGMGVRTNNIEDITSLSQLENLDLSNNKGIKAPLPPSLENLKNLKTLILVGCSFSGPIPDTVGSLKQLVFLYVFHILVFLYNIIFINDFLQCLAKLINLSWLDLSDNKLRDPFLSNEIALGLDMLKKARHFHLADNQLSGDIRFELFSSDMSLIHDIQQQSIIRNNPFLDWTCGYSSGTINWKFQVLVEQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039041`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039041

Location Chr09:57330813-57335322 (+)

Description Similar to At5g49770: Probable leucine-rich repeat receptor-like protein kinase At5g49770

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49760`	Leucine-rich repeat receptor protein kinase that acts as sensor of extracellular hydrogen peroxide.	Hydrogen peroxide sensor HPCA1 is an LRR receptor kinase in Arabidopsis.2020 · DOI: 10.1038/s41586-020-2032-3
`At5g49770`	Probable leucine-rich repeat receptor-like protein kinase At5g49770.	No verified direct reference in this release
`At3g12145`	Promotes flowering transition in long days (LD).	No verified direct reference in this release
`At3g14350`	Protein STRUBBELIG-RECEPTOR FAMILY 7.	No verified direct reference in this release
`At5g16590`	Might be involved in early recognition of growth promoting fungi.	A leucine-rich repeat protein is required for growth promotion and enhanced seed production mediated by the endophytic fungus Piriformospora indica in Arabidopsis thaliana.2007 · DOI: 10.1111/j.1365-313x.2007.03028.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039041 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009593 detection of chemical stimulus Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

GO:0048574 long-day photoperiodism, flowering Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT3G12145

ath:AT3G14350

ath:AT5G16590

ath:AT5G49760

ath:AT5G49770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.388

Rank 1 · LXL04_039041 · OH-1004

Extracellular0.211

Rank 2 · LXL04_039041 · OH-1004

Endoplasmic reticulum0.180

Rank 3 · LXL04_039041 · OH-1004

Cytoplasm0.153

Rank 4 · LXL04_039041 · OH-1004

Lysosome / Vacuole0.101

Rank 5 · LXL04_039041 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598.2LRR_1474-240 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039041	`PF23598.2`	LRR_14	74	240	6.2e-09	35.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GZ99`	Arabidopsis thaliana	Leucine-rich repeat receptor protein kinase HPCA1	43.243%	Swiss-Prot	moderate database homology
`Q9LT96`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase At5g49770	40.465%	Swiss-Prot	moderate database homology
`Q9LH52`	Arabidopsis thaliana	Leucine-rich repeat protein FLOR 1	30.846%	Swiss-Prot	weak database homology
`Q9LUL4`	Arabidopsis thaliana	Protein STRUBBELIG-RECEPTOR FAMILY 7	32.727%	Swiss-Prot	moderate database homology
`Q9FMD7`	Arabidopsis thaliana	Probable inactive receptor kinase At5g16590	33.505%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card