Gene Card
Gene overview
cDNA / CDS / Protein Sequences
723 bp · TkA08G160100|TK1151|cDNA
CAGGCCCTTGTGAATATTTGGGTTCGAAGGGAAATCAAAACTCCATTCCTCAATTGATCCCTATTTGCCAGCGACTTGCGTTTGAACTCCATGGACTCCGACGTGACAATGATACCCGCCGGCGAAGGATCGTCTGTCCCAGGGCCTTCTTCTTCAACGAAGAAACCCAAGCGTTTCGAAATCAAGAAGTGGAACGCCGTCGCTCTTTGGGCTTGGGATATTGTGGTCGACAATTGCGCAATTTGCAGGAATCACATCAT...
348 bp · TkA08G160100|TK1151|CDS
ATGGACTCCGACGTGACAATGATACCCGCCGGCGAAGGATCGTCTGTCCCAGGGCCTTCTTCTTCAACGAAGAAACCCAAGCGTTTCGAAATCAAGAAGTGGAACGCCGTCGCTCTTTGGGCTTGGGATATTGTGGTCGACAATTGCGCAATTTGCAGGAATCACATCATGGATCTCTGTATCGAATGCCAAGCTAATCAGGCTAGCGCCACCAGTGAGGAGTGTACCGTCGCTTGGGGTGTCTGTAACCATGCTTTTCA...
Protein
Download Protein FASTA115 aa · TkA08G160100|TK1151|PROTEIN
MDSDVTMIPAGEGSSVPGPSSSTKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G160100 |
|---|---|
| TK1151 ID | TkA08G160100 |
| OH-1004 ID | LXL04_015659 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 36.100 |
| Protein coverage (%) | TK1151 69.565 / OH-1004 72.897Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G160100 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:41770092-41771688 (-) | |||||||||
| Description | Similar to APC11: Anaphase-promoting complex subunit 11 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000278 mitotic cell cycle Biological Process GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0007346 regulation of mitotic cell cycle Biological Process GO:0016567 protein ubiquitination Biological Process GO:0031145 anaphase-promoting complex-dependent catabolic process Biological Process GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process GO:0045842 positive regulation of mitotic metaphase/anaphase transition Biological Process GO:0051301 cell division Biological Process GO:0051445 regulation of meiotic cell cycle Biological Process GO:0070936 protein K48-linked ubiquitination Biological Process GO:0070979 protein K11-linked ubiquitination Biological Process GO:0141198 protein branched polyubiquitination Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G05870 bta:616275 hsa:51529 mmu:66156 pon:100173127 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12678zf-rbx147-105 aaPF12861zf-ANAPC1147-111 aaPF13920zf-C3HC4_347-57 aaPF17120zf-RING_1647-79 aaPF17123zf-RING_1148-56 aaPF00097zf-C3HC449-103 aaPF13923zf-C3HC4_249-64 aaPF26010DUF800358-98 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G160100 | PF12678 | zf-rbx1 | 47 | 105 | 1.5e-25 | 89.8 |
| TkA08G160100 | PF12861 | zf-ANAPC11 | 47 | 111 | 7.7e-13 | 49.0 |
| TkA08G160100 | PF13920 | zf-C3HC4_3 | 47 | 57 | 0.54 | 10.8 |
| TkA08G160100 | PF17120 | zf-RING_16 | 47 | 79 | 3.8 | 7.9 |
| TkA08G160100 | PF17123 | zf-RING_11 | 48 | 56 | 0.014 | 15.8 |
| TkA08G160100 | PF00097 | zf-C3HC4 | 49 | 103 | 0.0005 | 20.6 |
| TkA08G160100 | PF13923 | zf-C3HC4_2 | 49 | 64 | 0.00089 | 19.7 |
| TkA08G160100 | PF26010 | DUF8003 | 58 | 98 | 0.17 | 13.0 |
| TkA08G160100 | PF22908 | PHD_NSD | 59 | 99 | 0.46 | 11.5 |
| TkA08G160100 | PF13920 | zf-C3HC4_3 | 59 | 107 | 0.54 | 10.8 |
| TkA08G160100 | PF13639 | zf-RING_2 | 60 | 103 | 3.6e-06 | 27.8 |
| TkA08G160100 | PF08746 | zf-RING-like | 60 | 102 | 8.6 | 7.3 |
| TkA08G160100 | PF17120 | zf-RING_16 | 78 | 102 | 3.8 | 7.9 |
| TkA08G160100 | PF13923 | zf-C3HC4_2 | 81 | 103 | 0.00089 | 19.7 |
| TkA08G160100 | PF17123 | zf-RING_11 | 81 | 91 | 0.014 | 15.8 |
| TkA08G160100 | PF13445 | zf-RING_UBOX | 82 | 102 | 0.41 | 11.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.