LXL04_015659 | RubberDandelionOmics

Gene overview

LXL04_015659

Reference: OH-1004 Chr: Chr03 Coordinates: 79280189-79283487 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

324 bp · LXL04_015659|LXL04_015659|OH1004|cDNA

atgggaGTGGCAAGAATCGAGCACGCGACTTCAGGTTTAACCCCGTTAAGCAAATGTCGTTACTGCTATCACCTGCCCTTCAAGTCAAGATGGCATGCAGTGGGGTCATGGACATGGGATGCTCATGATGAGACATGTGGGATATGTCGGATGGCGTTTGATGGTTGTTGTCCTGATTGTAAACTACCTGGTGATGATTGCCCACTAATTTGGGGTGCTTGCAATCATGCTTTCCATCTTCATTGCATATTGAAATGGGT...

CDS

Download CDS FASTA

324 bp · LXL04_015659|LXL04_015659|OH1004|CDS

ATGGGAGTGGCAAGAATCGAGCACGCGACTTCAGGTTTAACCCCGTTAAGCAAATGTCGTTACTGCTATCACCTGCCCTTCAAGTCAAGATGGCATGCAGTGGGGTCATGGACATGGGATGCTCATGATGAGACATGTGGGATATGTCGGATGGCGTTTGATGGTTGTTGTCCTGATTGTAAACTACCTGGTGATGATTGCCCACTAATTTGGGGTGCTTGCAATCATGCTTTCCATCTTCATTGCATATTGAAATGGGT...

Protein

Download Protein FASTA

107 aa · LXL04_015659|LXL04_015659|OH1004|PROTEIN

MGVARIEHATSGLTPLSKCRYCYHLPFKSRWHAVGSWTWDAHDETCGICRMAFDGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTPQAHCPMCRREWQFKE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015659`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015659

Location Chr03:79280189-79283487 (+)

Description Similar to APC11: Anaphase-promoting complex subunit 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05870`	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015659 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0007346 regulation of mitotic cell cycle Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031145 anaphase-promoting complex-dependent catabolic process Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0045842 positive regulation of mitotic metaphase/anaphase transition Biological Process

GO:0051301 cell division Biological Process

GO:0051445 regulation of meiotic cell cycle Biological Process

GO:0070936 protein K48-linked ubiquitination Biological Process

GO:0070979 protein K11-linked ubiquitination Biological Process

GO:0141198 protein branched polyubiquitination Biological Process

KEGG gene cross-reference

ath:AT3G05870

bta:616275

hsa:51529

mmu:66156

pon:100173127

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.477

Rank 1 · LXL04_015659 · OH-1004

Cytoplasm0.438

Rank 2 · LXL04_015659 · OH-1004

Cell membrane0.103

Rank 3 · LXL04_015659 · OH-1004

Endoplasmic reticulum0.074

Rank 4 · LXL04_015659 · OH-1004

Golgi apparatus0.067

Rank 5 · LXL04_015659 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12861.14zf-ANAPC1143-107 aa

PF12678.14zf-rbx144-100 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015659	`PF12861.14`	zf-ANAPC11	43	107	1.9e-34	118.2
LXL04_015659	`PF12678.14`	zf-rbx1	44	100	1.2e-21	77.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9L0`	Arabidopsis thaliana	Anaphase-promoting complex subunit 11	94.872%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card