TkA08G158620 | RubberDandelionOmics

Gene overview

TkA08G158620

Reference: TK1151 Chr: Chr08 Coordinates: 41300143-41302815 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2006 bp · TkA08G158620|TK1151|cDNA

AAATATGAGAATAATTTCATATCTCGCGTCCAAACACCCCCTTGGGCCTTGACCCCTATCCTTACCAAAGTAACAAACAGGATAGCGCCGCCGATTTTTTCCGGTGCGTAATGGCGGCGATTATGCCAAATTTCGGCCTCCGGCAGCTTCCCCTGCTTAACAAGTTCCGTTCATCTTTTCCTTCGTCGCCTTCACCGTCTCTATACCTTCATCGTTCTTCCTCTTCCATGACTTTACCCGTCGCCATTTCTTCTGATTTG...

CDS

Download CDS FASTA

1731 bp · TkA08G158620|TK1151|CDS

ATGGCGGCGATTATGCCAAATTTCGGCCTCCGGCAGCTTCCCCTGCTTAACAAGTTCCGTTCATCTTTTCCTTCGTCGCCTTCACCGTCTCTATACCTTCATCGTTCTTCCTCTTCCATGACTTTACCCGTCGCCATTTCTTCTGATTTGTCCTCTTCTTCAAATGAAGATTCCAAGGAACCCAAATTGAACACAGCCACATTATCCATCACCATTGAAGACCCAGATAACAGAAGTAAGAACAAAAAAGCCAAGCCTTT...

Protein

Download Protein FASTA

576 aa · TkA08G158620|TK1151|PROTEIN

MAAIMPNFGLRQLPLLNKFRSSFPSSPSPSLYLHRSSSSMTLPVAISSDLSSSSNEDSKEPKLNTATLSITIEDPDNRSKNKKAKPFFPKRGETLELVCESLAFKGKGLCKVEETGYVVMCDRALPGERFVGRVTRKKNNYAEVTKLKTLSPHTDIVEAPCEYALHCGGCKTQNLLYEAQVKAKEEQVRDLVVHVGKFSYKDPEFNNMMKPIVPCDMQFHYRNKMEFSFGPKRWLPKEQLQDKSQDSNVYSLGLHAPGLF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G158620`
TK1151 ID	TkA08G158620
OH-1004 ID	LXL04_032168
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G158620`
Location	Chr08:41300143-41302815 (+)
Description	Similar to CT0009: Uncharacterized RNA methyltransferase CT0009 (Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032168` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0070475 rRNA base methylation Biological Process GO:0046872 metal ion binding Molecular Function GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function GO:0070041 rRNA (uridine-C5-)-methyltransferase activity Molecular Function
KEGG gene cross-reference	bca:BCE_0363 bha:BH0687 bth:BT_0643 cte:CT0009 pgi:PG_1095 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.570

Rank 1 · TkA08G158620 · TK1151

Mitochondrion0.512

Rank 2 · TkA08G158620 · TK1151

Cytoplasm0.043

Rank 3 · TkA08G158620 · TK1151

Nucleus0.036

Rank 4 · TkA08G158620 · TK1151

Cell membrane0.012

Rank 5 · TkA08G158620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30636Methyltransf_37159-194 aa

PF13679Methyltransf_32161-179 aa

PF13679Methyltransf_32237-256 aa

PF05958tRNA_U5-meth_tr385-574 aa

PF01555N6_N4_Mtase400-459 aa

PF13679Methyltransf_32402-525 aa

PF13489Methyltransf_23406-469 aa

PF01209Ubie_methyltran409-481 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G158620	`PF30636`	Methyltransf_37	159	194	0.28	11.8
TkA08G158620	`PF13679`	Methyltransf_32	161	179	0.0026	18.4
TkA08G158620	`PF13679`	Methyltransf_32	237	256	0.0026	18.4
TkA08G158620	`PF05958`	tRNA_U5-meth_tr	385	574	8.6e-18	65.2
TkA08G158620	`PF01555`	N6_N4_Mtase	400	459	0.00025	21.8
TkA08G158620	`PF13679`	Methyltransf_32	402	525	0.0026	18.4
TkA08G158620	`PF13489`	Methyltransf_23	406	469	0.2	12.1
TkA08G158620	`PF01209`	Ubie_methyltran	409	481	0.067	13.3
TkA08G158620	`PF30636`	Methyltransf_37	417	495	0.28	11.8
TkA08G158620	`PF05175`	MTS	422	483	9e-07	29.3
TkA08G158620	`PF02475`	TRM5-TYW2_MTfase	422	483	2.1e-06	28.5
TkA08G158620	`PF06325`	PrmA	422	477	0.00067	20.0
TkA08G158620	`PF13847`	Methyltransf_31	423	500	4.4e-15	56.5
TkA08G158620	`PF09445`	Methyltransf_15	423	499	7.8e-07	29.5
TkA08G158620	`PF03602`	Cons_hypoth95	423	499	0.00045	20.7
TkA08G158620	`PF01170`	UPF0020	424	482	0.12	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card