LXL04_032168 | RubberDandelionOmics

Gene overview

LXL04_032168

Reference: OH-1004 Chr: Chr07 Coordinates: 17759375-17761771 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1731 bp · LXL04_032168|LXL04_032168|OH1004|cDNA

ATGGCGGCGATTATGCCAAATTTCGGCCTCCGGCAGCTTCCCCTGCTTAACAAGTTCCGTTCATCTTTTCCTTCGTCGCCTTCACCGTCTCTATACCTTCATCGTTCTTCCTTTTCCATGACTTTACCCGTCGCCATTTCTTCTGATTTGTCCTCTTCTTCAAATGAAGATTCCAAGGAACCCAAATTGAACACAGCCACATTATCCATCACCATTGAAGACCCAGATAACAGAAGTAAGAACAAAAAAGCCAAGCCTTT...

CDS

Download CDS FASTA

1731 bp · LXL04_032168|LXL04_032168|OH1004|CDS

ATGGCGGCGATTATGCCAAATTTCGGCCTCCGGCAGCTTCCCCTGCTTAACAAGTTCCGTTCATCTTTTCCTTCGTCGCCTTCACCGTCTCTATACCTTCATCGTTCTTCCTTTTCCATGACTTTACCCGTCGCCATTTCTTCTGATTTGTCCTCTTCTTCAAATGAAGATTCCAAGGAACCCAAATTGAACACAGCCACATTATCCATCACCATTGAAGACCCAGATAACAGAAGTAAGAACAAAAAAGCCAAGCCTTT...

Protein

Download Protein FASTA

576 aa · LXL04_032168|LXL04_032168|OH1004|PROTEIN

MAAIMPNFGLRQLPLLNKFRSSFPSSPSPSLYLHRSSFSMTLPVAISSDLSSSSNEDSKEPKLNTATLSITIEDPDNRSKNKKAKPFFPKRGETLELVCESLAFKGKGLCKVEETGYVVMCDRALPGERFVGRVTRKKNNYAEVTKLKTLSPHTDIVEAPCEYALHCGGCKTQNLLYEAQVKAKEEQVRDLVVHVGKFSYKDPEFNNMMKPIVPCDMQFHYRNKMEFSFGPKRWLPKEQLQDKSHDSNVYSLGLHAPGFF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032168`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_032168`
Location	Chr07:17759375-17761771 (-)
Description	Similar to CT0009: Uncharacterized RNA methyltransferase CT0009 (Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032168` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0070475 rRNA base methylation Biological Process GO:0046872 metal ion binding Molecular Function GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function GO:0070041 rRNA (uridine-C5-)-methyltransferase activity Molecular Function
KEGG gene cross-reference	bca:BCE_0363 bha:BH0687 bth:BT_0643 cte:CT0009 pgi:PG_1095 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.555

Rank 1 · LXL04_032168 · OH-1004

Mitochondrion0.525

Rank 2 · LXL04_032168 · OH-1004

Cytoplasm0.044

Rank 3 · LXL04_032168 · OH-1004

Nucleus0.037

Rank 4 · LXL04_032168 · OH-1004

Cell membrane0.013

Rank 5 · LXL04_032168 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05958.18tRNA_U5-meth_tr385-574 aa

PF05175.21MTS422-483 aa

PF02475.24TRM5-TYW2_MTfase422-484 aa

PF13847.13Methyltransf_31423-499 aa

PF09445.17Methyltransf_15423-499 aa

PF13649.13Methyltransf_25425-482 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032168	`PF05958.18`	tRNA_U5-meth_tr	385	574	9.2e-18	65.1
LXL04_032168	`PF05175.21`	MTS	422	483	7.2e-07	29.6
LXL04_032168	`PF02475.24`	TRM5-TYW2_MTfase	422	484	1e-06	29.5
LXL04_032168	`PF13847.13`	Methyltransf_31	423	499	1e-14	55.3
LXL04_032168	`PF09445.17`	Methyltransf_15	423	499	1e-06	29.1
LXL04_032168	`PF13649.13`	Methyltransf_25	425	482	2.3e-09	38.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card