TkA08G158420 | RubberDandelionOmics

Gene overview

TkA08G158420

Reference: TK1151 Chr: Chr08 Coordinates: 41246973-41249523 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1254 bp · TkA08G158420|TK1151|cDNA

GGTTACGATACTTTATTGGTACAGCGGGCTGATGGATGGACACGAGTCGGTAACGCCGTAACGGTGATTTGACGCGGCCCTACGTTAACTACAGTACGTTGTGAAACACTCGAATACAGCCCAAGTCTACTGTGTTCTTGATTATACTGGCCTAGGTTTATAAAGAGCGATTGACGGAGAGAGGCCGTGACTGAATCGGAGATACGCCGTCCGAATCTTGGAAGACAAAGTACAAGCGGGAGCCCAAATCAGCAGAAATG...

CDS

Download CDS FASTA

759 bp · TkA08G158420|TK1151|CDS

ATGACAGACCATGTGCAGGAGCAGGAGATGGAAATTGAAGCTTTAGAAGCCATTCTTATGGACGAATTTCAAGAAATCCACCCCAGTGAAAGTGGATTGAACACTTCTAACCGATGTTTCCAAATTACTTTGTCTCCACAGGATGATGATAATGAGGAATCTTTTACCACTCCAGTTCAATTGGGGTTAATTTTCTCACATACAGAAAAATATCCAGATGAAGTACCACTGCTAAATGTGCAAAGTATAAGAGGAATTCA...

Protein

Download Protein FASTA

252 aa · TkA08G158420|TK1151|PROTEIN

MTDHVQEQEMEIEALEAILMDEFQEIHPSESGLNTSNRCFQITLSPQDDDNEESFTTPVQLGLIFSHTEKYPDEVPLLNVQSIRGIHTSDLKVLKEKLEQEASENLGMAMIYTLVSSAKDWLSELYAQDDDNDNDEEEVAEKDEVIVPHGEPVTVDTFIAWRERFEAELALQRAKLMPESALTAPKEKRLSGRQWFETGRASSVKGAIPMEDGSDEEDEDFDFEDEDDFEDDEDDMLEHYLAEKSDSSVTAT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G158420`
TK1151 ID	TkA08G158420
OH-1004 ID	LXL04_032174
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G158420`
Location	Chr08:41246973-41249523 (-)
Description	Similar to Rwdd1: RWD domain-containing protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032174` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000077 DNA damage checkpoint signaling Biological Process GO:0002181 cytoplasmic translation Biological Process GO:0002230 positive regulation of defense response to virus by host Biological Process GO:0006446 regulation of translational initiation Biological Process GO:0006468 protein phosphorylation Biological Process GO:0010998 regulation of translational initiation by eIF2 alpha phosphorylation Biological Process GO:0019081 viral translation Biological Process GO:0030521 androgen receptor signaling pathway Biological Process GO:0032057 negative regulation of translational initiation in response to stress Biological Process GO:0034198 cellular response to amino acid starvation Biological Process GO:0034644 cellular response to UV Biological Process GO:0044828 host-mediated suppression of viral genome replication Biological Process
KEGG gene cross-reference	hsa:440275 hsa:51389 mmu:66521 rno:259218 spo:2538880 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.663

Rank 1 · TkA08G158420 · TK1151

Nucleus0.657

Rank 2 · TkA08G158420 · TK1151

Mitochondrion0.039

Rank 3 · TkA08G158420 · TK1151

Endoplasmic reticulum0.036

Rank 4 · TkA08G158420 · TK1151

Golgi apparatus0.032

Rank 5 · TkA08G158420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05773RWD6-122 aa

PF16543DFRP_C96-137 aa

PF30939At1g76070125-174 aa

PF29351Acidic_SOMP125-144 aa

PF16543DFRP_C151-224 aa

PF29351Acidic_SOMP210-239 aa

PF30939At1g76070214-227 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G158420	`PF05773`	RWD	6	122	7.9e-27	94.4
TkA08G158420	`PF16543`	DFRP_C	96	137	0.0063	17.7
TkA08G158420	`PF30939`	At1g76070	125	174	0.15	12.8
TkA08G158420	`PF29351`	Acidic_SOMP	125	144	0.98	9.1
TkA08G158420	`PF16543`	DFRP_C	151	224	0.0063	17.7
TkA08G158420	`PF29351`	Acidic_SOMP	210	239	0.98	9.1
TkA08G158420	`PF30939`	At1g76070	214	227	0.15	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card