Gene Card
Gene overview
cDNA / CDS / Protein Sequences
759 bp · LXL04_032174|LXL04_032174|OH1004|cDNA
ATGACAGACCATGTGCAGGAGCAGGAGATGGAAATTGAAGCTTTAGAAGCCATTCTTATGGACGAATTTCAAGAAATCCACCCCAGTGAAAGTGGATTGAACACTTCTAACCGATGTTTCCAAATTACTTTGTCTCCACAGGATGATGATAATGAGGAATCTTTTACCACTCCAGTTCAATTGGGGTTAATTTTCTCACATACAGAAAAATATCCAGATGAAGTACCACTGCTAAATGTGCAAAGTATAAGAGGAATTCA...
759 bp · LXL04_032174|LXL04_032174|OH1004|CDS
ATGACAGACCATGTGCAGGAGCAGGAGATGGAAATTGAAGCTTTAGAAGCCATTCTTATGGACGAATTTCAAGAAATCCACCCCAGTGAAAGTGGATTGAACACTTCTAACCGATGTTTCCAAATTACTTTGTCTCCACAGGATGATGATAATGAGGAATCTTTTACCACTCCAGTTCAATTGGGGTTAATTTTCTCACATACAGAAAAATATCCAGATGAAGTACCACTGCTAAATGTGCAAAGTATAAGAGGAATTCA...
Protein
Download Protein FASTA252 aa · LXL04_032174|LXL04_032174|OH1004|PROTEIN
MTDHVQEQEMEIEALEAILMDEFQEIHPSESGLNTSNRCFQITLSPQDDDNEESFTTPVQLGLIFSHTEKYPDEVPLLNVQSIRGIHTSDLKVLKEKLEQEASENLGMAMIYTLVSSAKDWLSELYAQDDDNDNDEEEVAEKDEVIVPHGEPVTVDTFIAWRERFEAELALQRAKLMPESALTAPKEKRLSGRQWFETGRASSVKGAIPMEDGSDEEDEDFDFEDEDDFEDDEDDMLEHYLAEKSDSSVTAT
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_032174 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_032174 |
|---|---|
| Location | Chr07:17823292-17825347 (+) |
| Description | Similar to Rwdd1: RWD domain-containing protein 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000077 DNA damage checkpoint signaling Biological Process GO:0002181 cytoplasmic translation Biological Process GO:0002230 positive regulation of defense response to virus by host Biological Process GO:0006446 regulation of translational initiation Biological Process GO:0006468 protein phosphorylation Biological Process GO:0010998 regulation of translational initiation by eIF2 alpha phosphorylation Biological Process GO:0019081 viral translation Biological Process GO:0030521 androgen receptor signaling pathway Biological Process GO:0032057 negative regulation of translational initiation in response to stress Biological Process GO:0034198 cellular response to amino acid starvation Biological Process GO:0034644 cellular response to UV Biological Process GO:0044828 host-mediated suppression of viral genome replication Biological Process |
| KEGG gene cross-reference | hsa:440275 hsa:51389 mmu:66521 rno:259218 spo:2538880 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF05773.28RWD6-122 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_032174 | PF05773.28 | RWD | 6 | 122 | 7.9e-27 | 94.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.