TkA08G155230 | RubberDandelionOmics

Gene overview

TkA08G155230

Reference: TK1151 Chr: Chr08 Coordinates: 40546060-40547955 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1824 bp · TkA08G155230|TK1151|cDNA

CGCAATCAGAAATTTGTCTCCTTGTCCGGAACCTCCAATTCCTCCGGAGCCGCACCCGCGTCTCTTCTAGAAACTTTTTTAAATTAACACCTAATTATGACCAACAACCATAATCAAAACAAACTCATTAACCACCACCACCAACTCCTCCCATCGCCGACCACCACCACCACCACCACCACTACCAATCGTTCCAATTCCTCCACCATCACCACCACCGCCCGCTCCAATTCCTCCCCCGTCACCACCGCACGTTCAAA...

CDS

Download CDS FASTA

1152 bp · TkA08G155230|TK1151|CDS

ATGACCAACAACCATAATCAAAACAAACTCATTAACCACCACCACCAACTCCTCCCATCGCCGACCACCACCACCACCACCACCACTACCAATCGTTCCAATTCCTCCACCATCACCACCACCGCCCGCTCCAATTCCTCCCCCGTCACCACCGCACGTTCAAACTCCACCACCCAAGCCTGCGCCGCCTGCCGCTACCAACGCCGGAAGTGCGCCCCTGACTGCGTCCTCGCGCCATATTTTCCGCACGACCGCCAACG...

Protein

Download Protein FASTA

383 aa · TkA08G155230|TK1151|PROTEIN

MTNNHNQNKLINHHHQLLPSPTTTTTTTTTNRSNSSTITTTARSNSSPVTTARSNSTTQACAACRYQRRKCAPDCVLAPYFPHDRQRQFQNAHKLFGVSNITKLIRDLDPPQKDEAMRTIIYQSDVRAQDPVEGCYRIIRELHRQIEYSRAELEIVLHQLAICRAHAVQNQNQNQNLHHHQDQLLIDGVDCDIHLVSNPDDPQLYDDLDTENVNHHNHGLDLDLGHITQQQEHEDHNAQIHDQGQDQYILGQQNLNNQGD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G155230`
TK1151 ID	TkA08G155230
OH-1004 ID	LXL04_032199
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	96.300
Protein coverage (%)	TK1151 98.956 / OH-1004 74.899 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G155230

Location Chr08:40546060-40547955 (+)

Description Similar to LBD22: LOB domain-containing protein 22

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g13850`	LOB domain-containing protein 22.	No verified direct reference in this release
`At1g72980`	LOB domain-containing protein 7.	No verified direct reference in this release
`At3g47870`	LOB domain-containing protein 27.	No verified direct reference in this release
`At1g65620`	Negative regulator of cell proliferation in the adaxial side of leaves.	No verified direct reference in this release
`At5g63090`	Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032199 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009555 pollen development Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0009786 regulation of asymmetric cell division Biological Process

GO:0009799 specification of symmetry Biological Process

GO:0009943 adaxial/abaxial axis specification Biological Process

GO:0009944 polarity specification of adaxial/abaxial axis Biological Process

GO:0009954 proximal/distal pattern formation Biological Process

GO:0010199 organ boundary specification between lateral organs and the meristem Biological Process

GO:0048441 petal development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G65620

ath:AT1G72980

ath:AT3G13850

ath:AT3G47870

ath:AT5G63090

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.965

Rank 1 · TkA08G155230 · TK1151

Cytoplasm0.097

Rank 2 · TkA08G155230 · TK1151

Cell membrane0.027

Rank 3 · TkA08G155230 · TK1151

Endoplasmic reticulum0.024

Rank 4 · TkA08G155230 · TK1151

Plastid0.010

Rank 5 · TkA08G155230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03195LOB60-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G155230	`PF03195`	LOB	60	155	1.5e-37	128.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LRW1`	Arabidopsis thaliana	sp\|Q9LRW1\|LBD22_ARATH LOB domain-containing protein 22	73.200%	Swiss-Prot	Low
`Q9SSM9`	Arabidopsis thaliana	sp\|Q9SSM9\|LBD7_ARATH LOB domain-containing protein 7	49.500%	Swiss-Prot	Low
`Q9STS6`	Arabidopsis thaliana	sp\|Q9STS6\|LBD27_ARATH LOB domain-containing protein 27	50.500%	Swiss-Prot	Low
`O04479`	Arabidopsis thaliana	sp\|O04479\|AS2_ARATH Protein ASYMMETRIC LEAVES 2	43.900%	Swiss-Prot	Low
`Q9FML4`	Arabidopsis thaliana	sp\|Q9FML4\|LOB_ARATH Protein LATERAL ORGAN BOUNDARIES	43.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card