TkA08G136690 | RubberDandelionOmics

Gene overview

TkA08G136690

Reference: TK1151 Chr: Chr08 Coordinates: 35508173-35509335 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

642 bp · TkA08G136690|TK1151|cDNA

ATGAGTACGCAAGAGATAAAGAGTAAGTATACAGGTTTGAAGGCTCCCCCTAAGTTTAAAGGTTTGAAGGCTGATCCCTCTGTTCCAAAAAGATCTAGAGCCACTTGGGACGAATGGAGTCAACAATTCCTATATCGTAATTTCACTGATGTGCCTCCCTCGATTGATTGGAGAGCTCGTGGTGCCGTCACCCCTGCCAAAAATCAAGCAAATTGTGGATCTTGCTACGCGTTTGGAGCAACGGATTCAGTGGAAGGATT...

CDS

Download CDS FASTA

642 bp · TkA08G136690|TK1151|CDS

ATGAGTACGCAAGAGATAAAGAGTAAGTATACAGGTTTGAAGGCTCCCCCTAAGTTTAAAGGTTTGAAGGCTGATCCCTCTGTTCCAAAAAGATCTAGAGCCACTTGGGACGAATGGAGTCAACAATTCCTATATCGTAATTTCACTGATGTGCCTCCCTCGATTGATTGGAGAGCTCGTGGTGCCGTCACCCCTGCCAAAAATCAAGCAAATTGTGGATCTTGCTACGCGTTTGGAGCAACGGATTCAGTGGAAGGATT...

Protein

Download Protein FASTA

213 aa · TkA08G136690|TK1151|PROTEIN

MSTQEIKSKYTGLKAPPKFKGLKADPSVPKRSRATWDEWSQQFLYRNFTDVPPSIDWRARGAVTPAKNQANCGSCYAFGATDSVEGLHAIRTGQLIELSPQEIVDCANIGGCDGGRVDMCFTYVKNNGGLTTMKNYPYVAKVETCNVKKGHDVAVPIGGFQQAPYGYEDDVLSAVAHQPVVFNIEVNDDFCSYKEGILTSQCGTAIEMEPSTG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G136690`
TK1151 ID	TkA08G136690
OH-1004 ID	LXL04_031909
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	61.500
Protein coverage (%)	TK1151 79.343 / OH-1004 17.195 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G136690

Location Chr08:35508173-35509335 (-)

Description Similar to CEP1: KDEL-tailed cysteine endopeptidase CEP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50260`	Possesses protease activity in vitro.	KDEL-tailed cysteine endopeptidases involved in programmed cell death, intercalation of new cells, and dismantling of extensin scaffolds.2008 · DOI: 10.3732/ajb.2007404 Endoplasmic reticulum KDEL-tailed cysteine endopeptidase 1 of Arabidopsis (AtCEP1) is involved in pathogen defense.2014 · DOI: 10.3389/fpls.2014.00058 The cysteine protease CEP1, a key executor involved in tapetal programmed cell death, regulates pollen development in Arabidopsis.2014 · DOI: 10.1105/tpc.114.127282

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0255300`	Cysteine endopeptidase that digests in vitro both the acidic and basic subunits of glutelin, the major seed storage protein of rice.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031909 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009555 pollen development Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0010623 programmed cell death involved in cell development Biological Process

GO:0048658 anther wall tapetum development Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051603 proteolysis involved in protein catabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005764 lysosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT5G50260

rcu:8278243

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.459

Rank 1 · TkA08G136690 · TK1151

Extracellular0.357

Rank 2 · TkA08G136690 · TK1151

Cytoplasm0.240

Rank 3 · TkA08G136690 · TK1151

Endoplasmic reticulum0.104

Rank 4 · TkA08G136690 · TK1151

Cell membrane0.075

Rank 5 · TkA08G136690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00112Peptidase_C151-204 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G136690	`PF00112`	Peptidase_C1	51	204	5.3e-43	148.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGR9`	Arabidopsis thaliana	sp\|Q9FGR9\|CEP1_ARATH KDEL-tailed cysteine endopeptidase CEP1	41.700%	Swiss-Prot	Medium
`Q7GDU7`	Oryza sativa subsp. japonica	sp\|Q7GDU7\|REPA_ORYSJ Cysteine endopeptidase RepA	46.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card