Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1401 bp · TkA08G136590|TK1151|cDNA
TTCATCATCAACATGCTTTGAATCCAAGAAAAGCAGCAAGAAACGAAAATGAGCAAATTAATTTTAGTTTCACTTACATTACTTTGGTGTTTAGGGGTGGCTGTCCACGGATTCACATATGACGAAAAAGAAATTAAAACGGAGCAGGGTAAGTTGGCCATGTTCGAAAGGTGGAGGAGCCACCACAAGATGGAGAAAATAAGCGAGAAAGAAAAAACAGTACAATACAATAATTTCAAGGCCACCTTGGAACATGTTCA...
1104 bp · TkA08G136590|TK1151|CDS
ATGAGCAAATTAATTTTAGTTTCACTTACATTACTTTGGTGTTTAGGGGTGGCTGTCCACGGATTCACATATGACGAAAAAGAAATTAAAACGGAGCAGGGTAAGTTGGCCATGTTCGAAAGGTGGAGGAGCCACCACAAGATGGAGAAAATAAGCGAGAAAGAAAAAACAGTACAATACAATAATTTCAAGGCCACCTTGGAACATGTTCACAATACAAACAAGGCGAATAAGTCATTTAAGTTAGAGATGAACCGGTT...
Protein
Download Protein FASTA367 aa · TkA08G136590|TK1151|PROTEIN
MSKLILVSLTLLWCLGVAVHGFTYDEKEIKTEQGKLAMFERWRSHHKMEKISEKEKTVQYNNFKATLEHVHNTNKANKSFKLEMNRFAGMNKAEFKSKFTGLRAAPPRIRPGKKIAIDHGGPFRYANFTNIPPSIDWRALGAVTPVKNQDQCASCYSFAAVDAVEGMHFIRNKELIALSPKEIVDCAQYDPPMGCVGGFVTISFEYIEKNGGLTTEKNYPYKPQVDPCNVKKEHDIAVQVGGHEIAPMNDEALTKALANQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G136590 |
|---|---|
| TK1151 ID | TkA08G136590 |
| OH-1004 ID | LXL04_031915 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G136590 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:35490091-35492042 (+) | |||||||||
| Description | Similar to Vignain | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006508 proteolysis Biological Process GO:0009555 pollen development Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0010623 programmed cell death involved in cell development Biological Process GO:0031667 response to nutrient levels Biological Process GO:0048658 anther wall tapetum development Biological Process GO:0050832 defense response to fungus Biological Process GO:0051603 proteolysis involved in protein catabolic process Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005576 extracellular region Cellular Component GO:0005615 extracellular space Cellular Component GO:0005764 lysosome Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT3G48340 ath:AT3G48350 ath:AT5G50260 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF11014DUF28524-105 aaPF08246Inhibitor_I2939-95 aaPF00112Peptidase_C145-65 aaPF00112Peptidase_C1131-345 aaPF03051Peptidase_C1_2145-164 aaPF13529Peptidase_C39_2256-313 aaPF03051Peptidase_C1_2287-324 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G136590 | PF11014 | DUF2852 | 4 | 105 | 0.085 | 13.7 |
| TkA08G136590 | PF08246 | Inhibitor_I29 | 39 | 95 | 2.4e-09 | 38.1 |
| TkA08G136590 | PF00112 | Peptidase_C1 | 45 | 65 | 2.1e-65 | 221.6 |
| TkA08G136590 | PF00112 | Peptidase_C1 | 131 | 345 | 2.1e-65 | 221.6 |
| TkA08G136590 | PF03051 | Peptidase_C1_2 | 145 | 164 | 4.8e-05 | 23.1 |
| TkA08G136590 | PF13529 | Peptidase_C39_2 | 256 | 313 | 0.19 | 12.8 |
| TkA08G136590 | PF03051 | Peptidase_C1_2 | 287 | 324 | 4.8e-05 | 23.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.