LXL04_031915 | RubberDandelionOmics

Gene overview

LXL04_031915

Reference: OH-1004 Chr: Chr07 Coordinates: 13243525-13245187 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1104 bp · LXL04_031915|LXL04_031915|OH1004|cDNA

ATGAGCAAATTAATTTTAGTTTCACTTACATTACTTTGGTGTTTAGGGGTGGCTGTCCACGGATTCACATATGacgaaaaagaaattaaaacgGAGCAGGGTAAGTTGGCCATGTTCGAAAGGTGGAGGAGCCACCACAAGATGGAGAAAATAAGCGAGAAAGAAAAAACAGTACAATACAATAATTTCAAGGCCACCTTGGAACATGTTCACAATACAAACAAGGCGAATAAGTCATTTAAGTTAGAGATGAACCGGTT...

CDS

Download CDS FASTA

1104 bp · LXL04_031915|LXL04_031915|OH1004|CDS

ATGAGCAAATTAATTTTAGTTTCACTTACATTACTTTGGTGTTTAGGGGTGGCTGTCCACGGATTCACATATGACGAAAAAGAAATTAAAACGGAGCAGGGTAAGTTGGCCATGTTCGAAAGGTGGAGGAGCCACCACAAGATGGAGAAAATAAGCGAGAAAGAAAAAACAGTACAATACAATAATTTCAAGGCCACCTTGGAACATGTTCACAATACAAACAAGGCGAATAAGTCATTTAAGTTAGAGATGAACCGGTT...

Protein

Download Protein FASTA

367 aa · LXL04_031915|LXL04_031915|OH1004|PROTEIN

MSKLILVSLTLLWCLGVAVHGFTYDEKEIKTEQGKLAMFERWRSHHKMEKISEKEKTVQYNNFKATLEHVHNTNKANKSFKLEMNRFAGMNKAEFKSKFTGLRAAPPRIRPGKKIAIDHGGPFRYANFTNIPPSIDWRALGAVTPVKNQDQCASCYSFAAVDAVEGMHFIRNKELIALSPKEIVDCAQYDPPMGCVGGFVTISFEYIEKNGGLTTEKNYPYKPQVDPCNVKKEHDIAVQVGGHEIAPMNDEALTKALANQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031915`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031915

Location Chr07:13243525-13245187 (+)

Description Similar to Vignain

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50260`	Possesses protease activity in vitro.	KDEL-tailed cysteine endopeptidases involved in programmed cell death, intercalation of new cells, and dismantling of extensin scaffolds.2008 · DOI: 10.3732/ajb.2007404 Endoplasmic reticulum KDEL-tailed cysteine endopeptidase 1 of Arabidopsis (AtCEP1) is involved in pathogen defense.2014 · DOI: 10.3389/fpls.2014.00058 The cysteine protease CEP1, a key executor involved in tapetal programmed cell death, regulates pollen development in Arabidopsis.2014 · DOI: 10.1105/tpc.114.127282
`At3g48340`	Involved in the final stage of developmental programmed cell death and in intercalation of new cells.	KDEL-tailed cysteine endopeptidases involved in programmed cell death, intercalation of new cells, and dismantling of extensin scaffolds.2008 · DOI: 10.3732/ajb.2007404
`At3g48350`	Involved in the final stage of developmental programmed cell death and in intercalation of new cells.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031915 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009555 pollen development Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0010623 programmed cell death involved in cell development Biological Process

GO:0031667 response to nutrient levels Biological Process

GO:0048658 anther wall tapetum development Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051603 proteolysis involved in protein catabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005764 lysosome Cellular Component

KEGG gene cross-reference

ath:AT3G48340

ath:AT3G48350

ath:AT5G50260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.522

Rank 1 · LXL04_031915 · OH-1004

Extracellular0.255

Rank 2 · LXL04_031915 · OH-1004

Cytoplasm0.246

Rank 3 · LXL04_031915 · OH-1004

Endoplasmic reticulum0.165

Rank 4 · LXL04_031915 · OH-1004

Cell membrane0.093

Rank 5 · LXL04_031915 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08246.18Inhibitor_I2939-95 aa

PF00112.30Peptidase_C1131-345 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031915	`PF08246.18`	Inhibitor_I29	39	95	2.4e-09	38.1
LXL04_031915	`PF00112.30`	Peptidase_C1	131	345	2.1e-65	221.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGR9`	Arabidopsis thaliana	KDEL-tailed cysteine endopeptidase CEP1	43.944%	Swiss-Prot	moderate database homology
`Q9STL4`	Arabidopsis thaliana	KDEL-tailed cysteine endopeptidase CEP2	44.875%	Swiss-Prot	moderate database homology
`Q9STL5`	Arabidopsis thaliana	KDEL-tailed cysteine endopeptidase CEP3	44.068%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card