TkA08G132900 | RubberDandelionOmics

Gene overview

TkA08G132900

Reference: TK1151 Chr: Chr08 Coordinates: 34531560-34548783 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

9739 bp · TkA08G132900|TK1151|cDNA

GGATTCTACGGCCTTTTGACCTCGTTTGTCCGCAAACCCTCTTTAGCCTTTCTCCTTTCTCCTTTCTCCCGCCACTTAAACCCTCTTGAAACAACCCAACTGACACAGTAAAAGTGTAAAACCCTAATTATCTCTCATATTCTCGTCCTAATTCGTCAGTGCTCGCAGTTGATTCATTTCCGGACTGTTTGTGCTCTTCTGGGATTATGCGATGGTCACGTCTGCAGATGTTCATGAAATCGTTTTGAAGCTCTCATCTG...

CDS

Download CDS FASTA

4044 bp · TkA08G132900|TK1151|CDS

ATGGTCACGTCTGCAGATGTTCATGAAATCGTTTTGAAGCTCTCATCTGATAAGGCCAAAGCCCGTGAAGAAGGGATTAAATTGTTGAATACATGGCTAGAAGGAGAAAGGTTGATCGAATTTTGTAGATATATAGGACGCAATACATCCATGCTCAAACCTCATGAGGTACCACATGCTGAAACTTGGCCTTTTCTTGTTAAATTGCTCACTGAAGCTATAAAGCTGGAGGTATCTGCAAGCAAGAAACGGTTGCCTAA...

Protein

Download Protein FASTA

1347 aa · TkA08G132900|TK1151|PROTEIN

MVTSADVHEIVLKLSSDKAKAREEGIKLLNTWLEGERLIEFCRYIGRNTSMLKPHEVPHAETWPFLVKLLTEAIKLEVSASKKRLPKLAFAKTLRIVVQRAEDGKSLHLLSVAKLLYNHIWKILNDVPSFQSEYGIILRHLLAVKQLQFHLRKSVYSSLVLFYMGKVEISLSEHITGQSIKEEVFRCILTLNSLLDSPPADFPDDLREGITKGFIDIFSNLRDEGKIVRNLVGCINTYLIRDGPNMGNRSLEIHDAVHKF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G132900`
TK1151 ID	TkA08G132900
OH-1004 ID	LXL04_031859
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.100
Protein coverage (%)	TK1151 98.886 / OH-1004 44.386 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G132900

Location Chr08:34531560-34548783 (-)

Description Similar to ATM: Serine/threonine-protein kinase ATM

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48190`	Serine/threonine protein kinase which activates checkpoint signaling upon genotoxic stresses such as ionizing radiation (IR) or DNA replication stalling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031859 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0000077 DNA damage checkpoint signaling Biological Process

GO:0000425 pexophagy Biological Process

GO:0000723 telomere maintenance Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0000729 DNA double-strand break processing Biological Process

GO:0001666 response to hypoxia Biological Process

GO:0002376 immune system process Biological Process

GO:0006281 DNA repair Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0006303 double-strand break repair via nonhomologous end joining Biological Process

GO:0006325 chromatin organization Biological Process

KEGG gene cross-reference

afm:AFUA_5G12660

hsa:472

mmu:11920

ssc:100101922

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.577

Rank 1 · TkA08G132900 · TK1151

Cytoplasm0.321

Rank 2 · TkA08G132900 · TK1151

Golgi apparatus0.082

Rank 3 · TkA08G132900 · TK1151

Endoplasmic reticulum0.077

Rank 4 · TkA08G132900 · TK1151

Cell membrane0.067

Rank 5 · TkA08G132900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11640TAN8-154 aa

PF02985HEAT489-502 aa

PF02985HEAT906-916 aa

PF02985HEAT1036-1062 aa

PF25360TPR_ATM1195-1332 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G132900	`PF11640`	TAN	8	154	0.00039	21.3
TkA08G132900	`PF02985`	HEAT	489	502	0.38	11.9
TkA08G132900	`PF02985`	HEAT	906	916	0.38	11.9
TkA08G132900	`PF02985`	HEAT	1036	1062	0.38	11.9
TkA08G132900	`PF25360`	TPR_ATM	1195	1332	3.5e-60	203.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M3G7`	Arabidopsis thaliana	sp\|Q9M3G7\|ATM_ARATH Serine/threonine-protein kinase ATM	47.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card