Gene Card
Gene overview
cDNA / CDS / Protein Sequences
519 bp · TkA08G132650|TK1151|cDNA
TTTCAGGTATTACAACAGCAGCAATGGTATGAAAAGAAAGCATCTATCGCTGAGATCGATTACAGTCGCAAAAAGTTACTACAGAAGCTAAAAGCATACAAAGGCGAGGACCTAGACGTCATCCATGAAGCTACCGCTTTTGCAAGCTCAACAGTAGAGAAAGAAAACACTGATCTCCTTCTTCCACCTTACCCAACCCGCCTTTCTCCTTCCCTTGACCCTGACAACGGTTACCTATCACATTTCTCATTAACACCCAA...
519 bp · TkA08G132650|TK1151|CDS
TTTCAGGTATTACAACAGCAGCAATGGTATGAAAAGAAAGCATCTATCGCTGAGATCGATTACAGTCGCAAAAAGTTACTACAGAAGCTAAAAGCATACAAAGGCGAGGACCTAGACGTCATCCATGAAGCTACCGCTTTTGCAAGCTCAACAGTAGAGAAAGAAAACACTGATCTCCTTCTTCCACCTTACCCAACCCGCCTTTCTCCTTCCCTTGACCCTGACAACGGTTACCTATCACATTTCTCATTAACACCCAA...
Protein
Download Protein FASTA172 aa · TkA08G132650|TK1151|PROTEIN
FQVLQQQQWYEKKASIAEIDYSRKKLLQKLKAYKGEDLDVIHEATAFASSTVEKENTDLLLPPYPTRLSPSLDPDNGYLSHFSLTPKILTNDPPNGHPKGSSLHQSEPRTSLQGFRQVIMAVAKRVIPIVGFIAALHLSGFEFGRRGSQPKVLGIYREQGNEEQSEMMVECP
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G132650 |
|---|---|
| TK1151 ID | TkA08G132650 |
| OH-1004 ID | LXL04_002350 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 98.800 |
| Protein coverage (%) | TK1151 98.837 / OH-1004 92.896Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G132650 |
|---|---|
| Location | Chr08:34457963-34458481 (-) |
| Description | Similar to PDV2: Plastid division protein PDV2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0009739 response to gibberellin Biological Process GO:0010020 chloroplast fission Biological Process GO:0005739 mitochondrion Cellular Component GO:0009536 plastid Cellular Component GO:0009707 chloroplast outer membrane Cellular Component GO:0070273 phosphatidylinositol-4-phosphate binding Molecular Function |
| KEGG gene cross-reference | ath:AT2G16070 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF28116PDV_N1-22 aaPF28116PDV_N39-52 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G132650 | PF28116 | PDV_N | 1 | 22 | 0.0013 | 19.9 |
| TkA08G132650 | PF28116 | PDV_N | 39 | 52 | 0.0013 | 19.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.