LXL04_002350 | RubberDandelionOmics

Gene overview

LXL04_002350

Reference: OH-1004 Chr: Chr01 Coordinates: 46802125-46803150 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

552 bp · LXL04_002350|LXL04_002350|OH1004|cDNA

atgAGAGAATCTCTCTTGTATTTTGTTGCAAATTTAGGGGTATTACAACAGCAGCAATGGTATGAAAAGAAAGCATCTATCGCTGAGATCGATTACAGTTGCAAAAAGTTACTACAGAAGCTAAAAGCATACAAAGGCGAGGACCTAGACGTCATCCATGAAGCTACCGCTTTTGCAAGCTCAACAGTAGAGAAAGAAAACACTGATCTCCTTCTTCCACCTTACCCAACCCGCCTTTCTCCTTCCCTTGACCCTGACAA...

CDS

Download CDS FASTA

552 bp · LXL04_002350|LXL04_002350|OH1004|CDS

ATGAGAGAATCTCTCTTGTATTTTGTTGCAAATTTAGGGGTATTACAACAGCAGCAATGGTATGAAAAGAAAGCATCTATCGCTGAGATCGATTACAGTTGCAAAAAGTTACTACAGAAGCTAAAAGCATACAAAGGCGAGGACCTAGACGTCATCCATGAAGCTACCGCTTTTGCAAGCTCAACAGTAGAGAAAGAAAACACTGATCTCCTTCTTCCACCTTACCCAACCCGCCTTTCTCCTTCCCTTGACCCTGACAA...

Protein

Download Protein FASTA

183 aa · LXL04_002350|LXL04_002350|OH1004|PROTEIN

MRESLLYFVANLGVLQQQQWYEKKASIAEIDYSCKKLLQKLKAYKGEDLDVIHEATAFASSTVEKENTDLLLPPYPTRLSPSLDPDNGYLSHFSLTPKILTNDPPNGHPKGSSLHQSEPRTSLQGFRQVIMAVAKRVILIVGFIAALHLSGFEFGRRGSQPKVLGIYREQGNEEQSEMMVECP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002350`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002350

Location Chr01:46802125-46803150 (+)

Description Similar to PDV2: Plastid division protein PDV2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g16070`	May act as a plastid division machinery component in coordinated constriction of the inner and outer envelope membranes.	PDV1 and PDV2 mediate recruitment of the dynamin-related protein ARC5 to the plastid division site.2006 · DOI: 10.1105/tpc.106.045484 Arabidopsis ARC6 coordinates the division machineries of the inner and outer chloroplast membranes through interaction with PDV2 in the intermembrane space.2008 · DOI: 10.1105/tpc.108.061440 Phosphatidylinositol 4-phosphate negatively regulates chloroplast division in Arabidopsis.2015 · DOI: 10.1105/tpc.115.136234 PDV2 has a dosage effect on chloroplast division in Arabidopsis.2017 · DOI: 10.1007/s00299-016-2096-6 PDV1 and PDV2 Differentially Affect Remodeling and Assembly of the Chloroplast DRP5B Ring.2020 · DOI: 10.1104/pp.19.01490

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002350 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009739 response to gibberellin Biological Process

GO:0010020 chloroplast fission Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009536 plastid Cellular Component

GO:0009707 chloroplast outer membrane Cellular Component

GO:0070273 phosphatidylinositol-4-phosphate binding Molecular Function

KEGG gene cross-reference

ath:AT2G16070

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.301

Rank 1 · LXL04_002350 · OH-1004

Cytoplasm0.277

Rank 2 · LXL04_002350 · OH-1004

Endoplasmic reticulum0.198

Rank 3 · LXL04_002350 · OH-1004

Mitochondrion0.190

Rank 4 · LXL04_002350 · OH-1004

Cell membrane0.159

Rank 5 · LXL04_002350 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XII1`	Arabidopsis thaliana	Plastid division protein PDV2	42.690%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card