TkA08G131410 | RubberDandelionOmics

Gene overview

TkA08G131410

Reference: TK1151 Chr: Chr08 Coordinates: 34109382-34111586 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2034 bp · TkA08G131410|TK1151|cDNA

ATGGCTACCTCTCTAACTACACCATTCTTAATCTTATCAATTTTTTTTATGCTCAATTCCATTCCAATCCCCTCATTCTCCTGCCCACTTCATCATAAACAAACACTTCTCAATTTCAAATCCACCCTCACCACCATCATCAATTCCAACTCGAGCTCCCTTCAATCCGTACAACTTAACTCATGGAATCCCAATTCCGATTGTTGCACATGGAACCGTGTTAAATGCAGCACAAATACGACCACAACAATTACTGAGCT...

CDS

Download CDS FASTA

2034 bp · TkA08G131410|TK1151|CDS

ATGGCTACCTCTCTAACTACACCATTCTTAATCTTATCAATTTTTTTTATGCTCAATTCCATTCCAATCCCCTCATTCTCCTGCCCACTTCATCATAAACAAACACTTCTCAATTTCAAATCCACCCTCACCACCATCATCAATTCCAACTCGAGCTCCCTTCAATCCGTACAACTTAACTCATGGAATCCCAATTCCGATTGTTGCACATGGAACCGTGTTAAATGCAGCACAAATACGACCACAACAATTACTGAGCT...

Protein

Download Protein FASTA

677 aa · TkA08G131410|TK1151|PROTEIN

MATSLTTPFLILSIFFMLNSIPIPSFSCPLHHKQTLLNFKSTLTTIINSNSSSLQSVQLNSWNPNSDCCTWNRVKCSTNTTTTITELHLSNVVPEFPNPVPVFSTILIPLFHIQSLKLLDLSSNSLSGNVPEEIVVNMKGLELFDLSDNLFSMKIPSDIGRLSNMVKLDLSKNQFTGPIPSSFQNLTKLETLRVEENKLSGVIPTWLFNVRTLKHLFIGGSGNNLIWNNKAKIVPMCSLEQISMTSCGISGQIPEWIASQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G131410`
TK1151 ID	TkA08G131410
OH-1004 ID	LXL04_031824
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	84.400
Protein coverage (%)	TK1151 97.637 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G131410

Location Chr08:34109382-34111586 (-)

Description Similar to RLP46: Receptor-like protein 46

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g04220`	Receptor-like protein 46.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031824 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010200 response to chitin Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G71400

ath:AT3G28890

ath:AT4G04220

ath:AT4G13810

ath:AT5G25910

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.830

Rank 1 · TkA08G131410 · TK1151

Endoplasmic reticulum0.100

Rank 2 · TkA08G131410 · TK1151

Cytoplasm0.059

Rank 3 · TkA08G131410 · TK1151

Nucleus0.042

Rank 4 · TkA08G131410 · TK1151

Lysosome / Vacuole0.032

Rank 5 · TkA08G131410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30053Ig_TRAPPC11_3rd15-76 aa

PF08263LRRNT_233-77 aa

PF27087LRR_TMOD-LMOD42-136 aa

PF24048LRR_NXF1-544-61 aa

PF13516LRR_682-90 aa

PF12799LRR_484-91 aa

PF23598LRR_14107-216 aa

PF25019LRR_R13L1-DRL21109-145 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G131410	`PF30053`	Ig_TRAPPC11_3rd	15	76	0.37	11.3
TkA08G131410	`PF08263`	LRRNT_2	33	77	2.3e-07	31.7
TkA08G131410	`PF27087`	LRR_TMOD-LMOD	42	136	0.12	12.7
TkA08G131410	`PF24048`	LRR_NXF1-5	44	61	0.011	16.1
TkA08G131410	`PF13516`	LRR_6	82	90	4.1e-07	30.3
TkA08G131410	`PF12799`	LRR_4	84	91	3.3e-25	88.2
TkA08G131410	`PF23598`	LRR_14	107	216	1.6e-25	90.3
TkA08G131410	`PF25019`	LRR_R13L1-DRL21	109	145	0.00044	20.9
TkA08G131410	`PF29460`	LRR_NXF2	110	127	0.069	13.6
TkA08G131410	`PF25013`	LRR_Zer-1	112	174	2.5e-07	31.6
TkA08G131410	`PF29594`	LRR_SKP2	112	195	0.039	13.9
TkA08G131410	`PF13516`	LRR_6	113	127	4.1e-07	30.3
TkA08G131410	`PF12799`	LRR_4	114	149	3.3e-25	88.2
TkA08G131410	`PF00560`	LRR_1	115	134	1.2e-49	156.2
TkA08G131410	`PF13855`	LRR_8	115	175	4.5e-38	129.5
TkA08G131410	`PF24048`	LRR_NXF1-5	115	146	0.011	16.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JGB6`	Arabidopsis thaliana	sp\|F4JGB6\|RLP46_ARATH Receptor-like protein 46	44.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card