LXL04_031824 | RubberDandelionOmics

Gene overview

LXL04_031824

Reference: OH-1004 Chr: Chr07 Coordinates: 11809823-11811979 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2157 bp · LXL04_031824|LXL04_031824|OH1004|cDNA

atgCTCAATTCCATTCCAATCCCCTCATTCTCCTGCCCACTTCATCATAAACAAACACTTCTCAATTTCAAATCCACCCTCACCACCATCATCAATTCCAACACGAGCTCCCTTCAATCCGTACAACTTAACTCATGGAATCCCAATTCCGATTGTTGCACATGGAACCGTGTTAAATGCAGCACAAATACGACCACAACAATTACTGAGCTACATCTCTCCAATGTTGTCCCGGAGTTTCCAAATCCGGTTCCGGTGTT...

CDS

Download CDS FASTA

2157 bp · LXL04_031824|LXL04_031824|OH1004|CDS

ATGCTCAATTCCATTCCAATCCCCTCATTCTCCTGCCCACTTCATCATAAACAAACACTTCTCAATTTCAAATCCACCCTCACCACCATCATCAATTCCAACACGAGCTCCCTTCAATCCGTACAACTTAACTCATGGAATCCCAATTCCGATTGTTGCACATGGAACCGTGTTAAATGCAGCACAAATACGACCACAACAATTACTGAGCTACATCTCTCCAATGTTGTCCCGGAGTTTCCAAATCCGGTTCCGGTGTT...

Protein

Download Protein FASTA

718 aa · LXL04_031824|LXL04_031824|OH1004|PROTEIN

MLNSIPIPSFSCPLHHKQTLLNFKSTLTTIINSNTSSLQSVQLNSWNPNSDCCTWNRVKCSTNTTTTITELHLSNVVPEFPNPVPVFSTILIPLFHIQSLKLLDLSSNSLSGNVPEEIGNLTKLRELYLGNNRFFGGIPSSIVNMKGLELFDLSDNLFSMKIPSDIGRLSNMVKLDLSKNQFTGPIPSSFQNLTKLETLRVEENKLSGVIPTWLFNVRTLKHLFIGGSGNNLIWNNKAKIVPMCSLEQISMTSCGISGQI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031824`
TK1151 ID	TkA08G131410
OH-1004 ID	LXL04_031824
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	84.400
Protein coverage (%)	TK1151 97.637 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031824

Location Chr07:11809823-11811979 (-)

Description Similar to RLP46: Receptor-like protein 46

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g04220`	Receptor-like protein 46.	No verified direct reference in this release
`At5g25910`	Required for defense against powdery mildew pathogen.	No verified direct reference in this release
`At1g71400`	Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.	Functional analyses of the CLAVATA2-like proteins and their domains that contribute to CLAVATA2 specificity.2010 · DOI: 10.1104/pp.109.148197
`At4g13810`	Receptor-like protein 47.	No verified direct reference in this release
`At3g28890`	Receptor-like protein 43.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031824 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010200 response to chitin Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G71400

ath:AT3G28890

ath:AT4G04220

ath:AT4G13810

ath:AT5G25910

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.840

Rank 1 · LXL04_031824 · OH-1004

Endoplasmic reticulum0.095

Rank 2 · LXL04_031824 · OH-1004

Cytoplasm0.058

Rank 3 · LXL04_031824 · OH-1004

Nucleus0.041

Rank 4 · LXL04_031824 · OH-1004

Lysosome / Vacuole0.031

Rank 5 · LXL04_031824 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_217-61 aa

PF13855.13LRR_896-134 aa

PF12799.14LRR_498-133 aa

PF23598.2LRR_1499-281 aa

PF13855.13LRR_8171-227 aa

PF13855.13LRR_8433-492 aa

PF12799.14LRR_4456-499 aa

PF13855.13LRR_8554-608 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031824	`PF08263.18`	LRRNT_2	17	61	2.4e-07	31.6
LXL04_031824	`PF13855.13`	LRR_8	96	134	1e-46	157.2
LXL04_031824	`PF12799.14`	LRR_4	98	133	1.1e-32	111.9
LXL04_031824	`PF23598.2`	LRR_14	99	281	4.2e-34	118.6
LXL04_031824	`PF13855.13`	LRR_8	171	227	1e-46	157.2
LXL04_031824	`PF13855.13`	LRR_8	433	492	1e-46	157.2
LXL04_031824	`PF12799.14`	LRR_4	456	499	1.1e-32	111.9
LXL04_031824	`PF13855.13`	LRR_8	554	608	1e-46	157.2
LXL04_031824	`PF12799.14`	LRR_4	554	584	1.1e-32	111.9
LXL04_031824	`PF23598.2`	LRR_14	566	651	4.2e-34	118.6
LXL04_031824	`PF13855.13`	LRR_8	590	632	1e-46	157.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JGB6`	Arabidopsis thaliana	Receptor-like protein 46	41.405%	Swiss-Prot	moderate database homology
`Q7FZR1`	Arabidopsis thaliana	Receptor-like protein 52	29.947%	Swiss-Prot	weak database homology
`Q9C9H7`	Arabidopsis thaliana	Receptor-like protein 12	30.759%	Swiss-Prot	moderate database homology
`Q9SVN2`	Arabidopsis thaliana	Receptor-like protein 47	30.341%	Swiss-Prot	moderate database homology
`Q9LJW7`	Arabidopsis thaliana	Receptor-like protein 43	31.989%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card