TkA08G131370 | RubberDandelionOmics

Gene overview

TkA08G131370

Reference: TK1151 Chr: Chr08 Coordinates: 34100040-34102523 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

738 bp · TkA08G131370|TK1151|cDNA

ATGACTTTCAGAAACACTATTTATGCGGCTGAAAAGCTCAAAGTCCCGATCATGCTTTACTGGACCCTTGCAGCTTGTGGATTCATGGCGATTTACCAGTCGAAAGTTCTAACGGACAAAGGACTTCTCCCACTTAAAGATGAAAGTTATCTTAAAAACGGGTACACGGATACACTAACAGATTGGATTCCAGGAATGGAAGGAACCCGTTTGAGGGATTTACCCGAACGTGTGTTAGTAACCGACTCCGATGATCCCAC...

CDS

Download CDS FASTA

738 bp · TkA08G131370|TK1151|CDS

ATGACTTTCAGAAACACTATTTATGCGGCTGAAAAGCTCAAAGTCCCGATCATGCTTTACTGGACCCTTGCAGCTTGTGGATTCATGGCGATTTACCAGTCGAAAGTTCTAACGGACAAAGGACTTCTCCCACTTAAAGATGAAAGTTATCTTAAAAACGGGTACACGGATACACTAACAGATTGGATTCCAGGAATGGAAGGAACCCGTTTGAGGGATTTACCCGAACGTGTGTTAGTAACCGACTCCGATGATCCCAC...

Protein

Download Protein FASTA

245 aa · TkA08G131370|TK1151|PROTEIN

MTFRNTIYAAEKLKVPIMLYWTLAACGFMAIYQSKVLTDKGLLPLKDESYLKNGYTDTLTDWIPGMEGTRLRDLPERVLVTDSDDPTYNYMLEAARAAGGWDVLPSDFMEAVETRGYIGSWRCSQEEVLNHPLVGGFLTHGGWGAVIESLSAGVPMLCWPVSHDQRINCRQMCVNWEVGMEIDMNVNKVEVEKLVRSLIDGFEGKQMKKKAMEWMKMAKLATNVNGSSFLNIKELANEITNLSTN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G131370`
TK1151 ID	TkA08G131370
OH-1004 ID	LXL04_031820
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	59.100
Protein coverage (%)	TK1151 72.245 / OH-1004 78.437 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G131370

Location Chr08:34100040-34102523 (+)

Description Similar to UGT85C1: UDP-glycosyltransferase 85C1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g22400`	Involved in the O-glucosylation of trans-zeatin and dihydrozeatin.	N-glucosylation of cytokinins by glycosyltransferases of Arabidopsis thaliana.2004 · DOI: 10.1074/jbc.m409569200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031820 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:1900994 (-)-secologanin biosynthetic process Biological Process

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function

GO:0102377 steviol 13-O glucosyltransferase activity Molecular Function

GO:0102378 steviolmonoside glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ag:BAK55737

ag:BAK55749

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.379

Rank 1 · TkA08G131370 · TK1151

Endoplasmic reticulum0.220

Rank 2 · TkA08G131370 · TK1151

Peroxisome0.180

Rank 3 · TkA08G131370 · TK1151

Plastid0.084

Rank 4 · TkA08G131370 · TK1151

Nucleus0.077

Rank 5 · TkA08G131370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201UDPGT124-214 aa

PF06722EryCIII-like_C136-207 aa

PF04101Glyco_tran_28_C138-217 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G131370	`PF00201`	UDPGT	124	214	1.6e-15	57.6
TkA08G131370	`PF06722`	EryCIII-like_C	136	207	0.00039	21.1
TkA08G131370	`PF04101`	Glyco_tran_28_C	138	217	0.031	15.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SK82`	Arabidopsis thaliana	sp\|Q9SK82\|U85A1_ARATH UDP-glycosyltransferase 85A1	30.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card