Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1116 bp · LXL04_031820|LXL04_031820|OH1004|cDNA
ATGAAAAGTACTGTCTTTGACAACAATTTGAGTTTTGCGTATGCAGATGAAAGTTATCTTAAAAACGGGTACACGGATACACTAATAGATTGGATTCCAGGAATGGAAGGAACCCGTTTGAGGGATTTACCCGAACGTGTGTTAGTAACCGACTCCGATGATCCCACATACAATTATATGTTGGAAGCAGCTCGTGCAGCCGATAAAGTTTCACACATGATCATCCATACTTTCGACGAATTAGAAGCTGCTTTAGTCAA...
1116 bp · LXL04_031820|LXL04_031820|OH1004|CDS
ATGAAAAGTACTGTCTTTGACAACAATTTGAGTTTTGCGTATGCAGATGAAAGTTATCTTAAAAACGGGTACACGGATACACTAATAGATTGGATTCCAGGAATGGAAGGAACCCGTTTGAGGGATTTACCCGAACGTGTGTTAGTAACCGACTCCGATGATCCCACATACAATTATATGTTGGAAGCAGCTCGTGCAGCCGATAAAGTTTCACACATGATCATCCATACTTTCGACGAATTAGAAGCTGCTTTAGTCAA...
Protein
Download Protein FASTA371 aa · LXL04_031820|LXL04_031820|OH1004|PROTEIN
MKSTVFDNNLSFAYADESYLKNGYTDTLIDWIPGMEGTRLRDLPERVLVTDSDDPTYNYMLEAARAADKVSHMIIHTFDELEAALVKELKSIFPNIYTIGPLQLLLNQTTKTESSSSNNYSLWKGKPEYIEWLGSKEPNSVVCVNFGSAVVMSLQDLLEFGWGLVNSNQYFLWIFRTGLVDGGWDVLPLDFMEAVETRGYIGSWRCSREEVLNHPSVGGFLTHGGWGSVIESLSAGVPMLCWPVSHDQRINCRQMCVNWE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_031820 |
|---|---|
| TK1151 ID | TkA08G131370 |
| OH-1004 ID | LXL04_031820 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 59.100 |
| Protein coverage (%) | TK1151 72.245 / OH-1004 78.437Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_031820 |
|---|---|
| Location | Chr07:11801989-11803872 (+) |
| Description | Similar to UGT85C1: UDP-glycosyltransferase 85C1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:1900994 (-)-secologanin biosynthetic process Biological Process GO:0035251 UDP-glucosyltransferase activity Molecular Function GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function GO:0102377 steviol 13-O glucosyltransferase activity Molecular Function GO:0102378 steviolmonoside glucosyltransferase activity Molecular Function |
| KEGG gene cross-reference | ag:BAK55737 ag:BAK55749 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00201.25UDPGT84-298 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_031820 | PF00201.25 | UDPGT | 84 | 298 | 3.3e-19 | 69.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.