TkA08G130640 | RubberDandelionOmics

Gene overview

TkA08G130640

Reference: TK1151 Chr: Chr08 Coordinates: 33892997-33894040 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

877 bp · TkA08G130640|TK1151|cDNA

AAACACCGTCTGTTTCATTATTTCGAACATCTATAGTAAAAAATGAGATTCTGGGGCAGTGGAACTAATCTCAACCGGCCAAAACGAGTGATCATCGGTCGTGTTTATGAAAAGTTCAAGCCCATCTTTGAATGGGGCGAAGAAGAAGATGATCATCATAGTCTTCACATTTATCTTCCTGGATTCCGAAAGGAGTTCATGAAGGTTACAACTGAAAATCCGAATATCCTTCGAATTTGTGGGGAGCGTTTTGTTGCTGG...

CDS

Download CDS FASTA

762 bp · TkA08G130640|TK1151|CDS

ATGAGATTCTGGGGCAGTGGAACTAATCTCAACCGGCCAAAACGAGTGATCATCGGTCGTGTTTATGAAAAGTTCAAGCCCATCTTTGAATGGGGCGAAGAAGAAGATGATCATCATAGTCTTCACATTTATCTTCCTGGATTCCGAAAGGAGTTCATGAAGGTTACAACTGAAAATCCGAATATCCTTCGAATTTGTGGGGAGCGTTTTGTTGCTGGAAACAAATGGGATTGGTTTAAGGAAGATTTTACACTTCCTAA...

Protein

Download Protein FASTA

253 aa · TkA08G130640|TK1151|PROTEIN

MRFWGSGTNLNRPKRVIIGRVYEKFKPIFEWGEEEDDHHSLHIYLPGFRKEFMKVTTENPNILRICGERFVAGNKWDWFKEDFTLPKTCKKSAIRAKLDGGILIITLPNKITNASSTTAKFPGDPLKTAKQTKDSANTSSSTLNATLPTQPPGVNSNGTFLNRNKEKGPITERTRETKRGSDSKIKERLEGCYMLMVKRLAMGMVGVKEGRIVVVNMVAVLVAVLVTAGLVFMLRTPLRPPQVNEFNLATYDQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G130640`
TK1151 ID	TkA08G130640
OH-1004 ID	LXL04_031798
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G130640`
Location	Chr08:33892997-33894040 (-)
Description	Similar to RTM2: Inactive protein RESTRICTED TEV MOVEMENT 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031798` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006952 defense response Biological Process GO:0009615 response to virus Biological Process GO:0046741 transport of virus in host, tissue to tissue Biological Process GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference	ath:AT5G04890 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.407

Rank 1 · TkA08G130640 · TK1151

Cell membrane0.322

Rank 2 · TkA08G130640 · TK1151

Nucleus0.237

Rank 3 · TkA08G130640 · TK1151

Cytoplasm0.148

Rank 4 · TkA08G130640 · TK1151

Golgi apparatus0.071

Rank 5 · TkA08G130640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00011HSP2034-114 aa

PF17886ArsA_HSP2036-106 aa

PF30192LAG2_C70-98 aa

PF17886ArsA_HSP20105-124 aa

PF00011HSP20176-196 aa

PF14654Epiglycanin_C211-236 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G130640	`PF00011`	HSP20	34	114	2.5e-09	37.9
TkA08G130640	`PF17886`	ArsA_HSP20	36	106	0.0052	17.1
TkA08G130640	`PF30192`	LAG2_C	70	98	0.17	12.9
TkA08G130640	`PF17886`	ArsA_HSP20	105	124	0.0052	17.1
TkA08G130640	`PF00011`	HSP20	176	196	2.5e-09	37.9
TkA08G130640	`PF14654`	Epiglycanin_C	211	236	0.19	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card