LXL04_031798 | RubberDandelionOmics

Gene overview

LXL04_031798

Reference: OH-1004 Chr: Chr07 Coordinates: 11465700-11466628 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

762 bp · LXL04_031798|LXL04_031798|OH1004|cDNA

ATGAGATTCTGGGGCAGTGGAACTAATCTCAACCGGCCAAAACGAGTGATCATCGGTCGTGTTTATGAAAAGTTCAAGCCCATCTTTGAATGGggcgaagaagaagatgatcaTCATAGTCTTCACATTTATCTTCCTGGATTCCGAAAGGAGTTCATGAAGGTTACAACTGAAAATCCGAATATCCTTCGAATTTGTGGGGAGCGTTTTGTTGCTGGAAACAAATGGGATTGGTTTAAGGAAGATTTTACACTTCCTAA...

CDS

Download CDS FASTA

762 bp · LXL04_031798|LXL04_031798|OH1004|CDS

ATGAGATTCTGGGGCAGTGGAACTAATCTCAACCGGCCAAAACGAGTGATCATCGGTCGTGTTTATGAAAAGTTCAAGCCCATCTTTGAATGGGGCGAAGAAGAAGATGATCATCATAGTCTTCACATTTATCTTCCTGGATTCCGAAAGGAGTTCATGAAGGTTACAACTGAAAATCCGAATATCCTTCGAATTTGTGGGGAGCGTTTTGTTGCTGGAAACAAATGGGATTGGTTTAAGGAAGATTTTACACTTCCTAA...

Protein

Download Protein FASTA

253 aa · LXL04_031798|LXL04_031798|OH1004|PROTEIN

MRFWGSGTNLNRPKRVIIGRVYEKFKPIFEWGEEEDDHHSLHIYLPGFRKEFMKVTTENPNILRICGERFVAGNKWDWFKEDFTLPKTCKKSAIRAKLDGGILIITLPNKITNASSTTAKFPGDPLKTAKQTKDSANTSSSTLNATLPTQPPGVNSNGTFLNRNKEKGPITERTRETKRGSGSKIKERLEGYYMLMVKRLAMGMVGVKEGRIVVVNMVAVLVAVLVTAGLVFMLRTPLRPPQVNEFNLATYDQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031798`
TK1151 ID	TkA08G130640
OH-1004 ID	LXL04_031798
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031798

Location Chr07:11465700-11466628 (-)

Description Similar to RTM2: Inactive protein RESTRICTED TEV MOVEMENT 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: D5K211`	Does not seem to be involved in heat resistance (By similarity).	No verified direct reference in this release
`UniProt: D9UBX6`	Does not seem to be involved in heat resistance (By similarity).	No verified direct reference in this release
`UniProt: D9UC01`	Does not seem to be involved in heat resistance (By similarity).	No verified direct reference in this release
`At5g04890`	Required for the restriction of long-distance movement of the pathogenic tobacco etch virus (TEV) without causing a hypersensitive response or inducing systemic acquired resistance.	Arabidopsis RTM2 gene is necessary for specific restriction of tobacco etch virus and encodes an unusual small heat shock-like protein.2000 · DOI: 10.1105/tpc.12.4.569
`UniProt: D9UBX4`	Does not seem to be involved in heat resistance (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031798 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009615 response to virus Biological Process

GO:0046741 transport of virus in host, tissue to tissue Biological Process

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT5G04890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.396

Rank 1 · LXL04_031798 · OH-1004

Cell membrane0.336

Rank 2 · LXL04_031798 · OH-1004

Nucleus0.235

Rank 3 · LXL04_031798 · OH-1004

Cytoplasm0.146

Rank 4 · LXL04_031798 · OH-1004

Golgi apparatus0.069

Rank 5 · LXL04_031798 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00011.28HSP2034-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031798	`PF00011.28`	HSP20	34	114	3.6e-09	37.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`D5K211`	Arabidopsis thaliana	Inactive protein RESTRICTED TEV MOVEMENT 2	38.710%	Swiss-Prot	weak database homology
`D9UBX6`	Arabidopsis thaliana	Inactive protein RESTRICTED TEV MOVEMENT 2	38.710%	Swiss-Prot	weak database homology
`D9UC01`	Arabidopsis thaliana	Inactive protein RESTRICTED TEV MOVEMENT 2	38.710%	Swiss-Prot	weak database homology
`Q9M670`	Arabidopsis thaliana	Protein RESTRICTED TEV MOVEMENT 2	38.710%	Swiss-Prot	weak database homology
`D9UBX4`	Arabidopsis thaliana	Inactive protein RESTRICTED TEV MOVEMENT 2	38.710%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card