TkA08G127260 | RubberDandelionOmics

Gene overview

TkA08G127260

Reference: TK1151 Chr: Chr08 Coordinates: 33098122-33099028 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

525 bp · TkA08G127260|TK1151|cDNA

TTATGCAGAATAATTTATACCATCTGGACCATAACTTATACCATCTGTGTGGGTTTTAATCTAGACATTGTTGGTTTTATTTTAGTAGAAGTTAGAGCGGGTGTGGCAAAGCCTCAGAGGGAGCCTCCGCCGGCGGGTGTGTCGGGTCGGCGGAGGGCAGGCGTGAAAGAAGGGTTCGAGACAGCAGCAAGCAGAAAGATGAAGCAAGACACAGAAAAGGGCATTTTCGTCCAGTTTTGCGCAGCCTTGGGAGAATCGTC...

CDS

Download CDS FASTA

525 bp · TkA08G127260|TK1151|CDS

TTATGCAGAATAATTTATACCATCTGGACCATAACTTATACCATCTGTGTGGGTTTTAATCTAGACATTGTTGGTTTTATTTTAGTAGAAGTTAGAGCGGGTGTGGCAAAGCCTCAGAGGGAGCCTCCGCCGGCGGGTGTGTCGGGTCGGCGGAGGGCAGGCGTGAAAGAAGGGTTCGAGACAGCAGCAAGCAGAAAGATGAAGCAAGACACAGAAAAGGGCATTTTCGTCCAGTTTTGCGCAGCCTTGGGAGAATCGTC...

Protein

Download Protein FASTA

174 aa · TkA08G127260|TK1151|PROTEIN

LCRIIYTIWTITYTICVGFNLDIVGFILVEVRAGVAKPQREPPPAGVSGRRRAGVKEGFETAASRKMKQDTEKGIFVQFCAALGESSIVVGVVYRILQWWFVSVVAGRVPVVTMEVTGEHRCILWLLVVITSKKQKLQSNLIASSSKKNTASSASSSKKAVASSCKITASSRQD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G127260`
TK1151 ID	TkA08G127260
OH-1004 ID	LXL04_025615
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	63.500
Protein coverage (%)	TK1151 41.954 / OH-1004 30.142 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G127260`
Location	Chr08:33098122-33099028 (-)
Description	Similar to At5g08350: GEM-like protein 4
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025615` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009793 embryo development ending in seed dormancy Biological Process GO:0009845 seed germination Biological Process GO:0010029 regulation of seed germination Biological Process GO:0098755 maintenance of seed dormancy by absisic acid Biological Process GO:0005737 cytoplasm Cellular Component GO:0009507 chloroplast Cellular Component GO:0009536 plastid Cellular Component
KEGG gene cross-reference	ath:AT5G08350 ath:AT5G13200 ath:AT5G23350 ath:AT5G23360 ath:AT5G23370 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.438

Rank 1 · TkA08G127260 · TK1151

Nucleus0.365

Rank 2 · TkA08G127260 · TK1151

Cell membrane0.132

Rank 3 · TkA08G127260 · TK1151

Mitochondrion0.128

Rank 4 · TkA08G127260 · TK1151

Endoplasmic reticulum0.083

Rank 5 · TkA08G127260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15817TMEM4058-120 aa

PF27961CSNKA2IP115-168 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G127260	`PF15817`	TMEM40	58	120	0.036	14.6
TkA08G127260	`PF27961`	CSNKA2IP	115	168	0.0055	17.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card