TkA08G126990 | RubberDandelionOmics

Gene overview

TkA08G126990

Reference: TK1151 Chr: Chr08 Coordinates: 33008929-33011677 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1984 bp · TkA08G126990|TK1151|cDNA

CGAAGTAAACTAGCTTTTTAGATTTTTTTTTTTTTTTCAAATAACGCCGGGCTTATAAATAATCACTTGGAAGTTACACTTCAAAGTGGAAATCCAACGAGAGCAAATTACAGAAATGGAAGACTTCCACTGGTACATCTTATTTCTAGGCTTAGCCTGTTCCATACATTTCGTTCCCAAAATAAACAATCAGCAGCCGCCAACTCTATCAGCCTTCAAAGTACTAGCCTACCTTTTCTTCTTCAAAGTTATAGACTACC...

CDS

Download CDS FASTA

1545 bp · TkA08G126990|TK1151|CDS

ATGGAAGACTTCCACTGGTACATCTTATTTCTAGGCTTAGCCTGTTCCATACATTTCGTTCCCAAAATAAACAATCAGCAGCCGCCAACTCTATCAGCCTTCAAAGTACTAGCCTACCTTTTCTTCTTCAAAGTTATAGACTACCTTTCTTCCTTCAAGCAGCAGCCTCTCCACCGATCCCTCCACCGCATCGCCACCCTCTACGGCCCAATTTCGCTTCTGCATTTGGGCTGCCGACCAGTCCTTCTAATCTCATCCTC...

Protein

Download Protein FASTA

514 aa · TkA08G126990|TK1151|PROTEIN

MEDFHWYILFLGLACSIHFVPKINNQQPPTLSAFKVLAYLFFFKVIDYLSSFKQQPLHRSLHRIATLYGPISLLHLGCRPVLLISSSSAAEDLFSNKNDAAFAHRPKLVVGKEFGSNYTNLAWAPHGGHWRHLRRVSCLEILPFHRLPDQFDSLSDEVKLLLGRLFHSEKKILELKPLFLDLVINVMMKMFAGKGYCPKKLTCKGNEKESISMMDYVTHSFRMTTDEPDVGYFVPILKFLGLISLEQRCKKLQEQGDSLM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G126990`
TK1151 ID	TkA08G126990
OH-1004 ID	LXL04_031738
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	93.300
Protein coverage (%)	TK1151 99.611 / OH-1004 29.060 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G126990

Location Chr08:33008929-33011677 (+)

Description Similar to CYP81Q32: Cytochrome P450 81Q32

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37400`	Involved in indole glucosinolate biosynthesis.	No verified direct reference in this release
`At5g36220`	Cytochrome P450 81D1.	No verified direct reference in this release
`At4g37430`	Involved in indole glucosinolate biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031738 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016020 membrane Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function

GO:0020037 heme binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.921

Rank 1 · TkA08G126990 · TK1151

Cytoplasm0.038

Rank 2 · TkA08G126990 · TK1151

Cell membrane0.034

Rank 3 · TkA08G126990 · TK1151

Plastid0.032

Rank 4 · TkA08G126990 · TK1151

Nucleus0.024

Rank 5 · TkA08G126990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p45050-487 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G126990	`PF00067`	p450	50	487	2.5e-85	287.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WTF4`	Arabidopsis thaliana	sp\|Q0WTF4\|C81F3_ARATH Cytochrome P450 81F3	41.600%	Swiss-Prot	Medium
`Q9FG65`	Arabidopsis thaliana	sp\|Q9FG65\|C81D1_ARATH Cytochrome P450 81D1	41.300%	Swiss-Prot	Medium
`O65790`	Arabidopsis thaliana	sp\|O65790\|C81F1_ARATH Cytochrome P450 81F1	39.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card