Gene Card
Gene overview
cDNA / CDS / Protein Sequences
5526 bp · LXL04_031738|LXL04_031738|OH1004|cDNA
ATGGAAGACTTCCACTGGTACATCTTATTTCTAGGCTTAGCCTGTTCCATACATTTCGTTCCCAAAATAAACAATCAGCAGCCGCCAACTCTATCAGCCTTCAAAGTACTAGCCTACCTTTTCTTCTTCAAAGTTATAGACTACCTTTCTTTCTTCAAGCAGCAGCCTCTCCACCGATCCCTCCACCGCATCGCCACCCTCTACGGCCCAATTTCGCTTCTGCATTTGGGCTGCCGACCAGTCCTTCTAATCTCATCCTC...
5526 bp · LXL04_031738|LXL04_031738|OH1004|CDS
ATGGAAGACTTCCACTGGTACATCTTATTTCTAGGCTTAGCCTGTTCCATACATTTCGTTCCCAAAATAAACAATCAGCAGCCGCCAACTCTATCAGCCTTCAAAGTACTAGCCTACCTTTTCTTCTTCAAAGTTATAGACTACCTTTCTTTCTTCAAGCAGCAGCCTCTCCACCGATCCCTCCACCGCATCGCCACCCTCTACGGCCCAATTTCGCTTCTGCATTTGGGCTGCCGACCAGTCCTTCTAATCTCATCCTC...
Protein
Download Protein FASTA1841 aa · LXL04_031738|LXL04_031738|OH1004|PROTEIN
MEDFHWYILFLGLACSIHFVPKINNQQPPTLSAFKVLAYLFFFKVIDYLSFFKQQPLHRSLHRIATLYGPISLLHLGCRPVLLISSSSAAEDLFSNKNDAAFAHRPKLVVGKEFGSNYTNLAWAPHGGHWRHLRRVSCLEILPFHRLPDQFDSLSDEVKLLLGRLFHSEKKILELKPLFLDLVINVMMKMFAGKGIKDFHNVVVTFSRYDGFDRYCPKKLTCKGNEKESISMMDYVTHSFRMTTDEPDVGYFVPILKFLG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_031738 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_031738 | ||||||
|---|---|---|---|---|---|---|---|
| Location | Chr07:10494257-10515847 (+) | ||||||
| Description | Similar to CYP81Q32: Cytochrome P450 81Q32 | ||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||
| GO annotations (OH1004 source) | GO:0016020 membrane Cellular Component GO:0004497 monooxygenase activity Molecular Function GO:0005506 iron ion binding Molecular Function GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function GO:0020037 heme binding Molecular Function | ||||||
| KEGG gene cross-reference | No functional description available |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00067.28p45053-506 aaPF00067.28p450553-1003 aaPF00067.28p4501119-1566 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_031738 | PF00067.28 | p450 | 53 | 506 | 8.5e-274 | 909.1 |
| LXL04_031738 | PF00067.28 | p450 | 553 | 1003 | 8.5e-274 | 909.1 |
| LXL04_031738 | PF00067.28 | p450 | 1119 | 1566 | 8.5e-274 | 909.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q9FG65 | Arabidopsis thaliana | Cytochrome P450 81D1 | 49.213% | Swiss-Prot | weak database homology |