RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G121330
Reference: TK1151 Chr: Chr08 Coordinates: 31580565-31584635 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2837 bp · TkA08G121330|TK1151|cDNA

ATCACGATATATATTTAAGTGTAGCTAAACCGTAAAGAATGGGGCAGAAAACAACGACAACTTTGAAAATCAAGGCTCTTTTATGAATACGATGTGGATTTGAGTTGACTGGGCGTCAAGTAAAACAGAGCATTCATAAATCATAATAATAATTACTTGATTTTTTGTGTTCAACCACCAGATCACATCTCATCATCCCACTTCAATTCTTCCTTGAAAAAATGGCAGACCACAATCACCACATAAGCATATTCCTCCTC...

CDS

Download CDS FASTA

1587 bp · TkA08G121330|TK1151|CDS

ATGGCAGACCACAATCACCACATAAGCATATTCCTCCTCCTCACTTTGTGTTGCTCTGTTTTCTGCAACTTTTGCTACTCAGAAACAGATACCTTACGAAAAGGTCAACATCTCACCGACTGGGATGAACTGATTTCACCAAACAAGGTCTTCGCTTTGAAATTCTTTAGCTTCGGCAGTAGTATCAAACCCTATTTAGGGATTTTCTACACTCACCGAAAAACGTCTGACCAAAATAAGGCAGTTTGGGTTGCAAACAG...

Protein

Download Protein FASTA

528 aa · TkA08G121330|TK1151|PROTEIN

MADHNHHISIFLLLTLCCSVFCNFCYSETDTLRKGQHLTDWDELISPNKVFALKFFSFGSSIKPYLGIFYTHRKTSDQNKAVWVANRNNPIKDIYGKLTIDDHGKLSILSVIDLFSPPTPCNASATLLDTGNFVLQELNPDGSVKQVLWQSFDYPTDTLLPGMKLGIDLKTGHRWSLTSWRSETQPADGSFTLTVDPIGTDQMAILRRGKVHWMSGSWQNGGFENTVLRYSPDVHLYYVSNETEQSFTYLTKTYDSSPAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G121330
TK1151 IDTkA08G121330
OH-1004 IDLXL04_031667
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)87.300
Protein coverage (%)TK1151 98.864 / OH-1004 66.123
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G121330
LocationChr08:31580565-31584635 (+)
DescriptionSimilar to At1g67520: G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g67520 G-type lectin S-receptor-like serine/threonine-protein kinase At1g67520. No verified direct reference in this release
At3g16030 Promotes the expression of genes involved in photosynthesis at least in dedifferentiated calli.
Arabidopsis mutants by activation tagging in which photosynthesis genes are expressed in dedifferentiated calli.2006 · DOI: 10.1093/pcp/pci242
At4g21380 Involved in the regulation of cellular expansion and differentiation. No verified direct reference in this release
At1g61480 G-type lectin S-receptor-like serine/threonine-protein kinase At1g61480. No verified direct reference in this release
At4g21390 G-type lectin S-receptor-like serine/threonine-protein kinase B120. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_031667 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006468 protein phosphorylation Biological Process
GO:0006955 immune response Biological Process
GO:0007165 signal transduction Biological Process
GO:0009620 response to fungus Biological Process
GO:0045087 innate immune response Biological Process
GO:0046777 protein autophosphorylation Biological Process
GO:0048544 recognition of pollen Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005773 vacuole Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT1G61610
ath:AT1G65800
ath:AT1G67520
ath:AT3G16030
ath:AT4G21380
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.752
Rank 1 · TkA08G121330 · TK1151
Extracellular0.103
Rank 2 · TkA08G121330 · TK1151
Endoplasmic reticulum0.088
Rank 3 · TkA08G121330 · TK1151
Cytoplasm0.084
Rank 4 · TkA08G121330 · TK1151
Nucleus0.038
Rank 5 · TkA08G121330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01453B_lectin82-181 aa
PF01453B_lectin245-249 aa
PF08277PAN_3286-297 aa
PF08276PAN_2292-302 aa
PF00024PAN_1294-305 aa
PF00024PAN_1318-369 aa
PF08277PAN_3321-358 aa
PF08276PAN_2323-349 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G121330PF01453B_lectin821815.7e-2898.2
TkA08G121330PF01453B_lectin2452495.7e-2898.2
TkA08G121330PF08277PAN_32862970.003218.0
TkA08G121330PF08276PAN_22923020.004917.7
TkA08G121330PF00024PAN_12943050.08813.4
TkA08G121330PF00024PAN_13183690.08813.4
TkA08G121330PF08277PAN_33213580.003218.0
TkA08G121330PF08276PAN_23233490.004917.7
TkA08G121330PF08277PAN_34244370.003218.0
TkA08G121330PF08277PAN_34614770.003218.0
TkA08G121330PF03109ABC14745050.211.5
TkA08G121330PF00069Pkinase4765280.0001821.7
TkA08G121330PF07714PK_Tyr_Ser-Thr4785250.0004120.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O64793Arabidopsis thalianasp|O64793|Y1675_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g6752037.000%Swiss-ProtMedium
Q9LW83Arabidopsis thalianasp|Q9LW83|CE101_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase CES10135.900%Swiss-ProtMedium
O81905Arabidopsis thalianasp|O81905|SD18_ARATH Receptor-like serine/threonine-protein kinase SD1-830.200%Swiss-ProtMedium
O64771Arabidopsis thalianasp|O64771|Y1148_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g6148029.600%Swiss-ProtLow
O81906Arabidopsis thalianasp|O81906|B120_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase B12030.300%Swiss-ProtMedium

JBrowse

View in Genome Browser