Gene Card
Gene overview
cDNA / CDS / Protein Sequences
396 bp · TkA08G121170|TK1151|cDNA
ATGGTTGCTGCTTGCTTAGTGAAAGATCCAAAAAATTGCCCCTCTTCGGAAAAGCTCTTGAAGCACCCGCTCTTTAAGCATGCAAAAACATGTGATTATTTGGAACGTACTATTCTTGATGGTCTTTCTCCATTAGGTGATCGTTTTATGATGCTAAAGGCCAAAGAAGATGATTTTCTTGTACAGAACAAGGACCTATATAGAGATAAGGACCATTTATCTCAGCAAGAGTATATACATGGAATTAGTGCATGGAACTT...
396 bp · TkA08G121170|TK1151|CDS
ATGGTTGCTGCTTGCTTAGTGAAAGATCCAAAAAATTGCCCCTCTTCGGAAAAGCTCTTGAAGCACCCGCTCTTTAAGCATGCAAAAACATGTGATTATTTGGAACGTACTATTCTTGATGGTCTTTCTCCATTAGGTGATCGTTTTATGATGCTAAAGGCCAAAGAAGATGATTTTCTTGTACAGAACAAGGACCTATATAGAGATAAGGACCATTTATCTCAGCAAGAGTATATACATGGAATTAGTGCATGGAACTT...
Protein
Download Protein FASTA131 aa · TkA08G121170|TK1151|PROTEIN
MVAACLVKDPKNCPSSEKLLKHPLFKHAKTCDYLERTILDGLSPLGDRFMMLKAKEDDFLVQNKDLYRDKDHLSQQEYIHGISAWNFNLEDLKNQAAFLNDLDEISSVEDPKTTEQQNGVNGVTVTVTSPQ
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G121170 |
|---|---|
| TK1151 ID | TkA08G121170 |
| OH-1004 ID | LXL04_031664 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 97.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 60.563Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G121170 |
|---|---|
| Location | Chr08:31532042-31532685 (+) |
| Description | Similar to fray2: Serine/threonine-protein kinase fray2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006611 protein export from nucleus Biological Process GO:1902456 regulation of stomatal opening Biological Process GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:1902554 serine/threonine protein kinase complex Cellular Component GO:0004674 protein serine/threonine kinase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0043539 protein serine/threonine kinase activator activity Molecular Function GO:0046872 metal ion binding Molecular Function GO:0106310 protein serine kinase activity Molecular Function |
| KEGG gene cross-reference | ath:AT4G14480 ddi:DDB_G0276577 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.