TkA08G118720 | RubberDandelionOmics

Gene overview

TkA08G118720

Reference: TK1151 Chr: Chr08 Coordinates: 30917269-30920740 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2458 bp · TkA08G118720|TK1151|cDNA

CTCACTCTGTCCAATTTTTTCGTGGCCCCATCCTTTCCCTGTCCGGGGTCTACTCCTCTACGCAAGGCTGTATCTTGGGTTACCGTAGACTCTCTCTCTCTCTCTCTCTCGCCCACCTCTCTCTCTATCTCTCTCTCCCCCCACTTCTCTCTCTCTCTCTCTCTCTCTCTCTCCACTTCTCTCTCTCTCTCTCTCTCCCACCGTTCTCTCCCCTTCTCAATCTCTCTCTCTCTCTCTCTCCCCACTTCTCTCTCTCTCTC...

CDS

Download CDS FASTA

1335 bp · TkA08G118720|TK1151|CDS

ATGATGGACGCGAGAAGACCTCATTTTATCAAGGGTTTTAACCCTAACATAAACTTCGATAAACTGCAAATACCTTTAAAATTCGGCAAACATCTGGAAGGGAAAACATCAGGAACAGTATCACTAATGGGACCCAGCGGGAACACTTGGCAAGCTGACATGGCACATCAAACCGATGGCATATTTATCCTAGATGGATGGGCAACTTTTGTAAGAGACCACTTTCTAGAAAACGGTGACTATATAGTATTCAGATACGA...

Protein

Download Protein FASTA

444 aa · TkA08G118720|TK1151|PROTEIN

MMDARRPHFIKGFNPNINFDKLQIPLKFGKHLEGKTSGTVSLMGPSGNTWQADMAHQTDGIFILDGWATFVRDHFLENGDYIVFRYDGNLHFTLQIFDQSSCEKETAFSAECHQDLSIFDQHFGKKREREYASLLSNMVDGVGVPKKPRSSQSHHNEPTSEQETINQHTHFLNGSEFFNSGLKSPITPALPLSAVRPNEDELGRISSSEAEKIAQNFNSSFPHFSQVMKRFNISGSYTLNVPYQFAMAYLPNCKVKIVLQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G118720`
TK1151 ID	TkA08G118720
OH-1004 ID	LXL04_032382
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	34.700
Protein coverage (%)	TK1151 22.072 / OH-1004 27.219 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G118720

Location Chr08:30917269-30920740 (+)

Description Similar to REM10: B3 domain-containing protein REM10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g18090`	B3 domain-containing protein At5g18090.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0621600`	Putative B3 domain-containing protein Os03g0621600.	No verified direct reference in this release
`Os06g0632500`	Putative B3 domain-containing protein Os06g0632500.	No verified direct reference in this release
`Os01g0723700`	B3 domain-containing protein Os03g0120900.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032382 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010601 positive regulation of auxin biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G24645

ath:AT2G24700

ath:AT4G00260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.970

Rank 1 · TkA08G118720 · TK1151

Cytoplasm0.068

Rank 2 · TkA08G118720 · TK1151

Cell membrane0.025

Rank 3 · TkA08G118720 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkA08G118720 · TK1151

Plastid0.009

Rank 5 · TkA08G118720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02362B315-99 aa

PF02362B3227-318 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G118720	`PF02362`	B3	15	99	1.1e-30	106.3
TkA08G118720	`PF02362`	B3	227	318	1.1e-30	106.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FK61`	Arabidopsis thaliana	sp\|Q9FK61\|Y5809_ARATH B3 domain-containing protein At5g18090	21.400%	Swiss-Prot	Low
`Q851V5`	Oryza sativa subsp. japonica	sp\|Q851V5\|Y3216_ORYSJ Putative B3 domain-containing protein Os03g0621600	26.300%	Swiss-Prot	Low
`Q67VL7`	Oryza sativa subsp. japonica	sp\|Q67VL7\|Y6325_ORYSJ Putative B3 domain-containing protein Os06g0632500	34.900%	Swiss-Prot	Low
`Q5JNA1`	Oryza sativa subsp. japonica	sp\|Q5JNA1\|Y1237_ORYSJ B3 domain-containing protein Os03g0120900	31.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card