TkA08G117970 | RubberDandelionOmics

Gene overview

TkA08G117970

Reference: TK1151 Chr: Chr08 Coordinates: 30738862-30740454 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1443 bp · TkA08G117970|TK1151|cDNA

ATGGCGACTACATCTTTAGCTTTCCCTTCTCTCAACAACCTGAATCTTGATGTCCAAAAGACATACCCACGTCGACGTCCCACCGCCGTCCACCTTATCACTGCCTCCAGCAAAGGCTCTGTTACGCCTCTCTCCGCCACCTCCGCCGATGTAGCTCCCACCGTTAGCGGTGACTCCACCACCAATCTCCCTCTCCGACAAGTCCCTGGCTCCTACGGCATTCCTTTCTTTCAACCACTTAAAGATCGATTTGAGTATTT...

CDS

Download CDS FASTA

1443 bp · TkA08G117970|TK1151|CDS

ATGGCGACTACATCTTTAGCTTTCCCTTCTCTCAACAACCTGAATCTTGATGTCCAAAAGACATACCCACGTCGACGTCCCACCGCCGTCCACCTTATCACTGCCTCCAGCAAAGGCTCTGTTACGCCTCTCTCCGCCACCTCCGCCGATGTAGCTCCCACCGTTAGCGGTGACTCCACCACCAATCTCCCTCTCCGACAAGTCCCTGGCTCCTACGGCATTCCTTTCTTTCAACCACTTAAAGATCGATTTGAGTATTT...

Protein

Download Protein FASTA

480 aa · TkA08G117970|TK1151|PROTEIN

MATTSLAFPSLNNLNLDVQKTYPRRRPTAVHLITASSKGSVTPLSATSADVAPTVSGDSTTNLPLRQVPGSYGIPFFQPLKDRFEYFYGAGGRDEYFKSRIQKFQSTVFRANMPPGPFISNNPNVVVLLDAKSFPTLFDVSKVEKKDLFTGTYMPSTELTGGYRVLSYLDPSEPNHAPLKNMIFFMLKSSRSRVMPEFEATYNELFDDLEAELAQKGKAFFNDAGEEAAFRFLGRAYLETNPEETKIGKDGPKLISTWVL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G117970`
TK1151 ID	TkA08G117970
OH-1004 ID	LXL04_031619
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	90.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G117970

Location Chr08:30738862-30740454 (+)

Description Similar to CYP74A2: Allene oxide synthase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42650`	Cytochrome P450 enzyme involved in the biosynthesis of oxylipin jasmonates, important phytohormones acting as growth regulators and signaling molecules for plant defense.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031619 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0016125 sterol metabolic process Biological Process

GO:0019373 epoxygenase P450 pathway Biological Process

GO:0031407 oxylipin metabolic process Biological Process

GO:0031408 oxylipin biosynthetic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT5G42650

sly:101266902

sly:606711

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.969

Rank 1 · TkA08G117970 · TK1151

Mitochondrion0.033

Rank 2 · TkA08G117970 · TK1151

Cytoplasm0.012

Rank 3 · TkA08G117970 · TK1151

Cell membrane0.010

Rank 4 · TkA08G117970 · TK1151

Endoplasmic reticulum0.009

Rank 5 · TkA08G117970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p450387-455 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G117970	`PF00067`	p450	387	455	0.00099	18.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q96242`	Arabidopsis thaliana	sp\|Q96242\|CP74A_ARATH Allene oxide synthase, chloroplastic	59.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card