LXL04_031619 | RubberDandelionOmics

Gene overview

LXL04_031619

Reference: OH-1004 Chr: Chr07 Coordinates: 8529377-8530969 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1593 bp · LXL04_031619|LXL04_031619|OH1004|cDNA

ATGGCGACTACATCTTTAGCTTTCCCTTCTCTCAACAACCTGAATCTTGATGTCCAAAAGACATACCCACGTCGACGTCCCACCGCCGTCCGCCTTATCACTGCCTCCAGCAAAGGCTCTGTTACGCCTCTCTCCGCCACCTCCGCCGATGTAGCTCCCACCGTTAGCGGTGACTCCACCACCAATCTCCCTCTCCGACAAGTCCCTGGCTCCTACGGCATTCCTTTCTTTCAACCACTTAAAGATCGATTTGAGTATTT...

CDS

Download CDS FASTA

1593 bp · LXL04_031619|LXL04_031619|OH1004|CDS

ATGGCGACTACATCTTTAGCTTTCCCTTCTCTCAACAACCTGAATCTTGATGTCCAAAAGACATACCCACGTCGACGTCCCACCGCCGTCCGCCTTATCACTGCCTCCAGCAAAGGCTCTGTTACGCCTCTCTCCGCCACCTCCGCCGATGTAGCTCCCACCGTTAGCGGTGACTCCACCACCAATCTCCCTCTCCGACAAGTCCCTGGCTCCTACGGCATTCCTTTCTTTCAACCACTTAAAGATCGATTTGAGTATTT...

Protein

Download Protein FASTA

530 aa · LXL04_031619|LXL04_031619|OH1004|PROTEIN

MATTSLAFPSLNNLNLDVQKTYPRRRPTAVRLITASSKGSVTPLSATSADVAPTVSGDSTTNLPLRQVPGSYGIPFFQPLKDRFEYFYGAGGRDEYFKSRIQKFQSTVFRANMPPGSFISNNPNVVVLLDAKSFPTLFDVSKVEKKDLFTGTYMPSTELTGGYRVLSYLDPSEPNHAPLKNMIFFMLKSSRSRVMPEFEATYNELFDDLEAELAQKGKAFFNDAGEEAAFRFLGRAYLETNPEETKIGKDGPKLISTWVL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031619`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031619

Location Chr07:8529377-8530969 (+)

Description Similar to CYP74A2: Allene oxide synthase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42650`	Cytochrome P450 enzyme involved in the biosynthesis of oxylipin jasmonates, important phytohormones acting as growth regulators and signaling molecules for plant defense.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031619 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0016125 sterol metabolic process Biological Process

GO:0019373 epoxygenase P450 pathway Biological Process

GO:0031407 oxylipin metabolic process Biological Process

GO:0031408 oxylipin biosynthetic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT5G42650

sly:101266902

sly:606711

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.951

Rank 1 · LXL04_031619 · OH-1004

Mitochondrion0.046

Rank 2 · LXL04_031619 · OH-1004

Cytoplasm0.011

Rank 3 · LXL04_031619 · OH-1004

Cell membrane0.010

Rank 4 · LXL04_031619 · OH-1004

Endoplasmic reticulum0.009

Rank 5 · LXL04_031619 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067.28p450358-505 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031619	`PF00067.28`	p450	358	505	1.8e-16	60.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q96242`	Arabidopsis thaliana	Allene oxide synthase, chloroplastic	61.437%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card