Gene Card
Gene overview
cDNA / CDS / Protein Sequences
315 bp · TkA08G116560|TK1151|cDNA
ATGTTCTGCTCGCCGGAGCATTTCCACGGCGGCAACATATCATCGACTGACGAGGATGAATGTGCAGTGTGTTTGAGAAGAATCGACGATGATGATGAGATTAGTGAGTTGAGGTGCAATCATGTCTGCCATAGAAATTGCTTGGATGTATGGCTCGAGTGTAGACATACGACATGTCCGGTATGTTATGATAACTTGCTGGCTCCGCCGAAGGTCGGCCACGGCAGCCATGGAATTGGAATTCAAGAATTGGTGTTCTT...
315 bp · TkA08G116560|TK1151|CDS
ATGTTCTGCTCGCCGGAGCATTTCCACGGCGGCAACATATCATCGACTGACGAGGATGAATGTGCAGTGTGTTTGAGAAGAATCGACGATGATGATGAGATTAGTGAGTTGAGGTGCAATCATGTCTGCCATAGAAATTGCTTGGATGTATGGCTCGAGTGTAGACATACGACATGTCCGGTATGTTATGATAACTTGCTGGCTCCGCCGAAGGTCGGCCACGGCAGCCATGGAATTGGAATTCAAGAATTGGTGTTCTT...
Protein
Download Protein FASTA104 aa · TkA08G116560|TK1151|PROTEIN
MFCSPEHFHGGNISSTDEDECAVCLRRIDDDDEISELRCNHVCHRNCLDVWLECRHTTCPVCYDNLLAPPKVGHGSHGIGIQELVFFDFCRVDSNSDYGTWWIR
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G116560 |
|---|---|
| TK1151 ID | TkA08G116560 |
| OH-1004 ID | LXL04_031602 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 94.231 / OH-1004 24.439Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G116560 |
|---|---|
| Location | Chr08:30378478-30378792 (-) |
| Description | Similar to ATL6: E3 ubiquitin-protein ligase ATL6 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006970 response to osmotic stress Biological Process GO:0009651 response to salt stress Biological Process GO:0009687 abscisic acid metabolic process Biological Process GO:0009688 abscisic acid biosynthetic process Biological Process GO:0009739 response to gibberellin Biological Process GO:0016567 protein ubiquitination Biological Process GO:0042742 defense response to bacterium Biological Process GO:0098542 defense response to other organism Biological Process GO:0005576 extracellular region Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0016020 membrane Cellular Component |
| KEGG gene cross-reference | ath:AT2G04240 ath:AT2G35420 ath:AT3G05200 dosa:Os03g0188200 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF14447Prok-RING_415-33 aaPF15150PMAIP117-30 aaPF12678zf-rbx118-62 aaPF17120zf-RING_1618-61 aaPF13639zf-RING_219-62 aaPF29452FAR1_N19-61 aaPF17123zf-RING_1120-48 aaPF13923zf-C3HC4_220-62 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G116560 | PF14447 | Prok-RING_4 | 15 | 33 | 2.2 | 9.0 |
| TkA08G116560 | PF15150 | PMAIP1 | 17 | 30 | 0.26 | 11.9 |
| TkA08G116560 | PF12678 | zf-rbx1 | 18 | 62 | 0.00044 | 21.2 |
| TkA08G116560 | PF17120 | zf-RING_16 | 18 | 61 | 0.0032 | 17.7 |
| TkA08G116560 | PF13639 | zf-RING_2 | 19 | 62 | 1.2e-10 | 42.2 |
| TkA08G116560 | PF29452 | FAR1_N | 19 | 61 | 0.093 | 13.5 |
| TkA08G116560 | PF17123 | zf-RING_11 | 20 | 48 | 2.6e-05 | 24.5 |
| TkA08G116560 | PF13923 | zf-C3HC4_2 | 20 | 62 | 0.00028 | 21.3 |
| TkA08G116560 | PF14634 | zf-RING_5 | 20 | 62 | 0.00032 | 21.3 |
| TkA08G116560 | PF25998 | U-box_ZFPL1 | 20 | 65 | 0.36 | 12.0 |
| TkA08G116560 | PF11793 | FANCL_C | 20 | 56 | 2.8 | 9.0 |
| TkA08G116560 | PF00097 | zf-C3HC4 | 21 | 62 | 3.5e-06 | 27.5 |
| TkA08G116560 | PF13445 | zf-RING_UBOX | 21 | 51 | 0.0033 | 18.1 |
| TkA08G116560 | PF12861 | zf-ANAPC11 | 30 | 64 | 1.1 | 10.1 |
| TkA08G116560 | PF31263 | RING_Ste5 | 34 | 54 | 0.13 | 12.8 |
| TkA08G116560 | PF14447 | Prok-RING_4 | 39 | 64 | 2.2 | 9.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.