LXL04_031602 | RubberDandelionOmics

Gene overview

LXL04_031602

Reference: OH-1004 Chr: Chr07 Coordinates: 8183940-8187843 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1206 bp · LXL04_031602|LXL04_031602|OH1004|cDNA

ATGTTCTGCTCGCCGGAGCATTTCCACGGCGGCAACATATCATCGACTGACGAGGATGAATGTGCAGTGTGTTTGAGAAGAATCGACGATGATGATGAGATTAGTGAGTTGAGGTGCAATCATGTCTGCCATAGAAATTGCTTGGATGTATGGCTCGAGTGTAGACATACGACATGTCCGGTATGTTATGATAACTTGCTGGCTCCGCCGAAGGTCGGCCACGGCAGCCATGGAATTGGAATTCAAGAATTGGTGTTCTT...

CDS

Download CDS FASTA

1206 bp · LXL04_031602|LXL04_031602|OH1004|CDS

ATGTTCTGCTCGCCGGAGCATTTCCACGGCGGCAACATATCATCGACTGACGAGGATGAATGTGCAGTGTGTTTGAGAAGAATCGACGATGATGATGAGATTAGTGAGTTGAGGTGCAATCATGTCTGCCATAGAAATTGCTTGGATGTATGGCTCGAGTGTAGACATACGACATGTCCGGTATGTTATGATAACTTGCTGGCTCCGCCGAAGGTCGGCCACGGCAGCCATGGAATTGGAATTCAAGAATTGGTGTTCTT...

Protein

Download Protein FASTA

401 aa · LXL04_031602|LXL04_031602|OH1004|PROTEIN

MFCSPEHFHGGNISSTDEDECAVCLRRIDDDDEISELRCNHVCHRNCLDVWLECRHTTCPVCYDNLLAPPKVGHGSHGIGIQELVFFDFCRVDSNSDYDDIPSPGSRPPAVRDNAKRIVRHNEDHEKKMKQRDDIVAKLDAHLSSVDEKKSMKRRQLELQEETQEGTILLNHLSILEKNGLEDQDREIVATAKNKSHDIPSPGSRPPAGRDNAKRIVRHNEDHEKKMKQRDDIVAKLDAHLSSVDEKKSMKRRQLELQEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031602`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031602

Location Chr07:8183940-8187843 (-)

Description Similar to ATL6: E3 ubiquitin-protein ligase ATL6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05200`	E3 ubiquitin-protein ligase able to catalyze polyubiquitination with ubiquitin-conjugating enzyme E2 UBC8 in vitro.	No verified direct reference in this release
`At1g35330`	RING-H2 finger protein ATL34.	No verified direct reference in this release
`At2g35420`	RING-H2 finger protein ATL28.	No verified direct reference in this release
`At2g04240`	Function on abscisic acid homeostasis at post-translational level, probably through ubiquitin/proteasome-dependent substrate- specific degradation.	Upregulation of an Arabidopsis RING-H2 gene, XERICO, confers drought tolerance through increased abscisic acid biosynthesis.2006 · DOI: 10.1111/j.1365-313x.2006.02782.x Global analysis of della direct targets in early gibberellin signaling in Arabidopsis.2007 · DOI: 10.1105/tpc.107.054999

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0188200`	Possesses E3 ubiquitin-protein ligase in vitro.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031602 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009687 abscisic acid metabolic process Biological Process

GO:0009688 abscisic acid biosynthetic process Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT2G04240

ath:AT2G35420

ath:AT3G05200

dosa:Os03g0188200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.519

Rank 1 · LXL04_031602 · OH-1004

Nucleus0.518

Rank 2 · LXL04_031602 · OH-1004

Cell membrane0.070

Rank 3 · LXL04_031602 · OH-1004

Mitochondrion0.043

Rank 4 · LXL04_031602 · OH-1004

Endoplasmic reticulum0.030

Rank 5 · LXL04_031602 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13639.13zf-RING_219-62 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031602	`PF13639.13`	zf-RING_2	19	62	1.2e-09	38.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXX9`	Arabidopsis thaliana	E3 ubiquitin-protein ligase ATL6	52.000%	Swiss-Prot	weak database homology
`Q9C7I1`	Arabidopsis thaliana	RING-H2 finger protein ATL34	37.037%	Swiss-Prot	weak database homology
`Q6NKR1`	Arabidopsis thaliana	RING-H2 finger protein ATL28	31.967%	Swiss-Prot	weak database homology
`Q9SI09`	Arabidopsis thaliana	Probable E3 ubiquitin-protein ligase XERICO	38.889%	Swiss-Prot	weak database homology
`Q8H7N9`	Oryza sativa subsp. japonica	E3 ubiquitin-protein ligase Os03g0188200	51.923%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card