TkA08G116370 | RubberDandelionOmics

Gene overview

TkA08G116370

Reference: TK1151 Chr: Chr08 Coordinates: 30313824-30318255 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

429 bp · TkA08G116370|TK1151|cDNA

ATGGTGCTGTATGAAGCTATTATGACATTGTACGGTATGCAGGGAGGTACGAGCAATTTGGAAGAATGCATAACTCATGGACCATGGGTTGGTGCTCATGGGAAAGCCTGGACGTATATGCCCCAAACCTCTATTAAAACGATTAGGATTATATATGGAAAGCTTATCGATTGCCTCATATTCCAAAACGATTCTCATACAGGTGAAAGTCAAACCTCTATCTTCGGTGGCAATGGAGGCAACAAAACATCTATGATATG...

CDS

Download CDS FASTA

429 bp · TkA08G116370|TK1151|CDS

ATGGTGCTGTATGAAGCTATTATGACATTGTACGGTATGCAGGGAGGTACGAGCAATTTGGAAGAATGCATAACTCATGGACCATGGGTTGGTGCTCATGGGAAAGCCTGGACGTATATGCCCCAAACCTCTATTAAAACGATTAGGATTATATATGGAAAGCTTATCGATTGCCTCATATTCCAAAACGATTCTCATACAGGTGAAAGTCAAACCTCTATCTTCGGTGGCAATGGAGGCAACAAAACATCTATGATATG...

Protein

Download Protein FASTA

142 aa · TkA08G116370|TK1151|PROTEIN

MVLYEAIMTLYGMQGGTSNLEECITHGPWVGAHGKAWTYMPQTSIKTIRIIYGKLIDCLIFQNDSHTGESQTSIFGGNGGNKTSMICINYPNEYLTSISGTIDFYTSSAVLMSLCFHTNQKGYGPYGTCDTGSRFSYGADKD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G116370`
TK1151 ID	TkA08G116370
OH-1004 ID	LXL04_031597
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 90.845 / OH-1004 16.025 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G116370

Location Chr08:30313824-30318255 (-)

Description Similar to Mannose/glucose-specific lectin (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g73040`	Jacalin-related lectin 19.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031597 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007157 heterophilic cell-cell adhesion Biological Process

GO:0045840 positive regulation of mitotic nuclear division Biological Process

GO:0051781 positive regulation of cell division Biological Process

GO:0005536 D-glucose binding Molecular Function

GO:0005537 D-mannose binding Molecular Function

GO:0008061 chitin binding Molecular Function

GO:0030247 polysaccharide binding Molecular Function

GO:0050839 cell adhesion molecule binding Molecular Function

GO:0070492 oligosaccharide binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.591

Rank 1 · TkA08G116370 · TK1151

Nucleus0.335

Rank 2 · TkA08G116370 · TK1151

Extracellular0.148

Rank 3 · TkA08G116370 · TK1151

Cell membrane0.062

Rank 4 · TkA08G116370 · TK1151

Mitochondrion0.049

Rank 5 · TkA08G116370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01419Jacalin27-138 aa

PF28405DUF839070-120 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G116370	`PF01419`	Jacalin	27	138	2.4e-21	77.3
TkA08G116370	`PF28405`	DUF8390	70	120	0.072	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SSM3`	Arabidopsis thaliana	sp\|Q9SSM3\|JAL19_ARATH Jacalin-related lectin 19	35.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card