LXL04_031597 | RubberDandelionOmics

Gene overview

LXL04_031597

Reference: OH-1004 Chr: Chr07 Coordinates: 8120884-8129128 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2418 bp · LXL04_031597|LXL04_031597|OH1004|cDNA

atgaCAATGAAACACAAGGGAGGTACGAGCAATTTGGAAGAATGCATAACTCATGGACCATGGGTTGGTGCTCATGGGAAAGCCTGGACGTATATGCCCCAAACCTCTATTAAAACGATTAGGATTATATATGGAAAGCTTATCGATTGCCTCATATTCCAAAACGATTCTCATACAGGTGAAAGTCAAACCTCTATCTTCGGTGGCAATGGAGGCAACAAAACATCTATGATATGCATCAATTACCCTAATGAGTATCT...

CDS

Download CDS FASTA

2418 bp · LXL04_031597|LXL04_031597|OH1004|CDS

ATGACAATGAAACACAAGGGAGGTACGAGCAATTTGGAAGAATGCATAACTCATGGACCATGGGTTGGTGCTCATGGGAAAGCCTGGACGTATATGCCCCAAACCTCTATTAAAACGATTAGGATTATATATGGAAAGCTTATCGATTGCCTCATATTCCAAAACGATTCTCATACAGGTGAAAGTCAAACCTCTATCTTCGGTGGCAATGGAGGCAACAAAACATCTATGATATGCATCAATTACCCTAATGAGTATCT...

Protein

Download Protein FASTA

805 aa · LXL04_031597|LXL04_031597|OH1004|PROTEIN

MTMKHKGGTSNLEECITHGPWVGAHGKAWTYMPQTSIKTIRIIYGKLIDCLIFQNDSHTGESQTSIFGGNGGNKTSMICINYPNEYLTSISGTIDFYTSSAVLMSLCFHTNQKGYGPYGTCDTGSRFSYGADKDCMVVGFHGRVGQCINAIGIYSMPKSLAFNRNSTNSNREMSLTAMPRDAGPWGASGAKPWDDGVFCDIKQIRVHVGKSLKVIHAIQFEYVKRDGESILSQIHGGKGGEKTEVVDLDYPGEYLTGISG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031597`
TK1151 ID	TkA08G116370
OH-1004 ID	LXL04_031597
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 90.845 / OH-1004 16.025 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031597

Location Chr07:8120884-8129128 (-)

Description Similar to Mannose/glucose-specific lectin (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g19715`	Jacalin-related lectin 3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031597 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007157 heterophilic cell-cell adhesion Biological Process

GO:0045840 positive regulation of mitotic nuclear division Biological Process

GO:0051781 positive regulation of cell division Biological Process

GO:0005536 D-glucose binding Molecular Function

GO:0005537 D-mannose binding Molecular Function

GO:0008061 chitin binding Molecular Function

GO:0030247 polysaccharide binding Molecular Function

GO:0050839 cell adhesion molecule binding Molecular Function

GO:0070492 oligosaccharide binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.726

Rank 1 · LXL04_031597 · OH-1004

Nucleus0.302

Rank 2 · LXL04_031597 · OH-1004

Cell membrane0.097

Rank 3 · LXL04_031597 · OH-1004

Extracellular0.070

Rank 4 · LXL04_031597 · OH-1004

Endoplasmic reticulum0.057

Rank 5 · LXL04_031597 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01419.23Jacalin19-154 aa

PF01419.23Jacalin183-312 aa

PF01419.23Jacalin326-459 aa

PF01419.23Jacalin480-618 aa

PF01419.23Jacalin653-786 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031597	`PF01419.23`	Jacalin	19	154	9.1e-136	447.7
LXL04_031597	`PF01419.23`	Jacalin	183	312	9.1e-136	447.7
LXL04_031597	`PF01419.23`	Jacalin	326	459	9.1e-136	447.7
LXL04_031597	`PF01419.23`	Jacalin	480	618	9.1e-136	447.7
LXL04_031597	`PF01419.23`	Jacalin	653	786	9.1e-136	447.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HQX1`	Arabidopsis thaliana	Jacalin-related lectin 3	31.897%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card