TkA08G115550 | RubberDandelionOmics

Gene overview

TkA08G115550

Reference: TK1151 Chr: Chr08 Coordinates: 30107105-30109235 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

687 bp · TkA08G115550|TK1151|cDNA

ATGCCATTCACGAGCATTCGCCCATTTCCACCCACCATCATTGCACCACGAGTTTACCACCACCTTGTCTCCGCTGTGGCAGCATCTTCGGGAACCGCCATTACATCCCTAAATCACTCACCACTTCTCACTTCTACTACAAGGACACATCGACTTGATGGAACGATGGTGGCTAAAAAGAGTGGAATTGGATTCAAAAATTACATTTACATGGAATTGGAGAACAATATTGCGGCCACGACTGTTGATATTATTATTTT...

CDS

Download CDS FASTA

687 bp · TkA08G115550|TK1151|CDS

ATGCCATTCACGAGCATTCGCCCATTTCCACCCACCATCATTGCACCACGAGTTTACCACCACCTTGTCTCCGCTGTGGCAGCATCTTCGGGAACCGCCATTACATCCCTAAATCACTCACCACTTCTCACTTCTACTACAAGGACACATCGACTTGATGGAACGATGGTGGCTAAAAAGAGTGGAATTGGATTCAAAAATTACATTTACATGGAATTGGAGAACAATATTGCGGCCACGACTGTTGATATTATTATTTT...

Protein

Download Protein FASTA

228 aa · TkA08G115550|TK1151|PROTEIN

MPFTSIRPFPPTIIAPRVYHHLVSAVAASSGTAITSLNHSPLLTSTTRTHRLDGTMVAKKSGIGFKNYIYMELENNIAATTVDIIIFLIPIGLEECIRFVANFKLSKEDIAFLRECLSPKCEDAFFDYLESIDSQDVEVYAIAEGSVVFPKVPPMRIEGPVAVVQLLETPYVNLINFASLVTTNAARHRFVAGKDKLLLEFGLQRPRGPDGGVGASRYCYMGGFDVTR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G115550`
TK1151 ID	TkA08G115550
OH-1004 ID	LXL04_029988
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	92.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G115550

Location Chr08:30107105-30109235 (+)

Description Similar to NAPRT2: Nicotinate phosphoribosyltransferase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36940`	Catalyzes the first step in the biosynthesis of NAD from nicotinic acid, the ATP-dependent synthesis of beta-nicotinate D-ribonucleotide from nicotinate and 5-phospho-D-ribose 1-phosphate.	No verified direct reference in this release
`At2g23420`	Catalyzes the first step in the biosynthesis of NAD from nicotinic acid, the ATP-dependent synthesis of beta-nicotinate D-ribonucleotide from nicotinate and 5-phospho-D-ribose 1-phosphate.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029988 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0034355 NAD+ biosynthetic process via the salvage pathway Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004516 nicotinate phosphoribosyltransferase activity Molecular Function

GO:0016740 transferase activity Molecular Function

GO:0016757 glycosyltransferase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G23420

ath:AT4G36940

bta:399559

cel:CELE_Y54G2A.17

ddi:DDB_G0268472

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.967

Rank 1 · TkA08G115550 · TK1151

Mitochondrion0.041

Rank 2 · TkA08G115550 · TK1151

Cytoplasm0.038

Rank 3 · TkA08G115550 · TK1151

Peroxisome0.029

Rank 4 · TkA08G115550 · TK1151

Nucleus0.018

Rank 5 · TkA08G115550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17767NAPRTase_N92-176 aa

PF26372DUF8096101-116 aa

PF21623HK_sensor_dom_bact106-163 aa

PF02749QRPTase_N134-179 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G115550	`PF17767`	NAPRTase_N	92	176	2.4e-18	67.4
TkA08G115550	`PF26372`	DUF8096	101	116	0.23	11.8
TkA08G115550	`PF21623`	HK_sensor_dom_bact	106	163	0.42	10.5
TkA08G115550	`PF02749`	QRPTase_N	134	179	0.00011	23.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWM2`	Arabidopsis thaliana	sp\|Q8RWM2\|NPRT1_ARATH Nicotinate phosphoribosyltransferase 1	72.100%	Swiss-Prot	Medium
`Q84WV8`	Arabidopsis thaliana	sp\|Q84WV8\|NPRT2_ARATH Nicotinate phosphoribosyltransferase 2	71.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card