TkA08G112410 | RubberDandelionOmics

Gene overview

TkA08G112410

Reference: TK1151 Chr: Chr08 Coordinates: 29237864-29240323 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1977 bp · TkA08G112410|TK1151|cDNA

GAGAGAGAGAGAGAGAGAGAGAGTATGGGTTTTGTATTAAATTGAGGTAGCAGGGGGGAGAGGGGGTTTGCAGTGGCTATGGCGGCGTTGCAGGGGGCGTGATTTTAATGCATCCAAATAACAAAAAGACAGAATTCATAAGAAAAAAAAAAGGAAAAAAAAAAAGAGAATGAATGATCCAAAACCCTTCCTTTTCTCTTCCATAAAAATTCTTTCATTCTAGTTATTTCTTTTTATTTTTCAAAAAAATTCCCTGCAAT...

CDS

Download CDS FASTA

825 bp · TkA08G112410|TK1151|CDS

ATGAGGCAAGCTGGGTATGGCATCGGCGGAGGAGATCACGGTGGTGGTGGCAGCGGTAGTGGTGGTGGCGGAATGAATTGTCAAGATTGCGGTAATCAAGCAAAGAAAGATTGTCAGCATATGAGGTGTAGAACTTGCTGTAAAAGCCGTGGGTTTCAGTGTCAAACCCATGTCAAGAGCACCTGGGTTCCCGCAGCTAAACGGCGGGAACGTCAGCAACAGCTAACGTCGTTATCCCAACAGCAGCAGCATAATTTAGG...

Protein

Download Protein FASTA

274 aa · TkA08G112410|TK1151|PROTEIN

MRQAGYGIGGGDHGGGGSGSGGGGMNCQDCGNQAKKDCQHMRCRTCCKSRGFQCQTHVKSTWVPAAKRRERQQQLTSLSQQQQHNLGNQQLSLMMRGGAGGIEQNPKRLREDHHQLMTTAGGGGGGVTLNLPSTHPHNSSSGLEVGHFPAEVSSPAIFRCVRVSAMDDAEEQLAYQTAVNIGGHLFKGILYDHGPEGRYNHPGGGDSSGGGGSQHQQLNLITSGTMGSPPPPPPSIRMSVLLILRLYIQLLSMLSWPVRN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G112410`
TK1151 ID	TkA08G112410
OH-1004 ID	LXL04_031537
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	90.500
Protein coverage (%)	TK1151 74.453 / OH-1004 54.974 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G112410

Location Chr08:29237864-29240323 (+)

Description Similar to SRS5: Protein SHI RELATED SEQUENCE 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51060`	Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering.	STY1 and STY2 promote the formation of apical tissues during Arabidopsis gynoecium development.2002 · DOI: 10.1242/dev.129.20.4707 STY1 regulates auxin homeostasis and affects apical-basal patterning of the Arabidopsis gynoecium.2006 · DOI: 10.1111/j.1365-313x.2006.02775.x Functionally redundant SHI family genes regulate Arabidopsis gynoecium development in a dose-dependent manner.2006 · DOI: 10.1111/j.1365-313x.2006.02774.x Auxin can act independently of CRC, LUG, SEU, SPT and STY1 in style development but not apical-basal patterning of the Arabidopsis gynoecium.2008 · DOI: 10.1111/j.1469-8137.2008.02625.x The Arabidopsis thaliana STYLISH1 protein acts as a transcriptional activator regulating auxin biosynthesis.2010 · DOI: 10.1105/tpc.108.064816 The Arabidopsis thaliana transcriptional activator STYLISH1 regulates genes affecting stamen development, cell expansion and timing of flowering.2012 · DOI: 10.1007/s11103-012-9888-z
`At1g19790`	Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering.	Functionally redundant SHI family genes regulate Arabidopsis gynoecium development in a dose-dependent manner.2006 · DOI: 10.1111/j.1365-313x.2006.02774.x Activation tagging of an Arabidopsis SHI-RELATED SEQUENCE gene produces abnormal anther dehiscence and floral development.2010 · DOI: 10.1007/s11103-010-9677-5
`At5g66350`	Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering.	No verified direct reference in this release
`At1g75520`	Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering.	Functionally redundant SHI family genes regulate Arabidopsis gynoecium development in a dose-dependent manner.2006 · DOI: 10.1111/j.1365-313x.2006.02774.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031537 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009299 mRNA transcription Biological Process

GO:0009555 pollen development Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009851 auxin biosynthetic process Biological Process

GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0048653 anther development Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G19790

ath:AT1G75520

ath:AT3G51060

ath:AT5G66350

sly:101251254

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.982

Rank 1 · TkA08G112410 · TK1151

Cytoplasm0.081

Rank 2 · TkA08G112410 · TK1151

Cell membrane0.023

Rank 3 · TkA08G112410 · TK1151

Endoplasmic reticulum0.018

Rank 4 · TkA08G112410 · TK1151

Plastid0.008

Rank 5 · TkA08G112410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05142DUF70224-196 aa

PF28914Trissin25-47 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G112410	`PF05142`	DUF702	24	196	1e-66	224.9
TkA08G112410	`PF28914`	Trissin	25	47	1.1	9.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SD40`	Arabidopsis thaliana	sp\|Q9SD40\|SRS1_ARATH Protein SHI RELATED SEQUENCE 1	48.600%	Swiss-Prot	Medium
`Q9FXH7`	Arabidopsis thaliana	sp\|Q9FXH7\|SRS7_ARATH Protein SHI RELATED SEQUENCE 7	61.000%	Swiss-Prot	Medium
`Q9XGX0`	Arabidopsis thaliana	sp\|Q9XGX0\|SHI_ARATH Protein SHORT INTERNODES	46.900%	Swiss-Prot	Medium
`Q9LQZ5`	Arabidopsis thaliana	sp\|Q9LQZ5\|SRS5_ARATH Protein SHI RELATED SEQUENCE 5	56.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card