TkA08G112120 | RubberDandelionOmics

Gene overview

TkA08G112120

Reference: TK1151 Chr: Chr08 Coordinates: 29154178-29157152 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1480 bp · TkA08G112120|TK1151|cDNA

CTCGAAAATTCAAATTATTTGGTTGTTGGTGGACTGATTTGATTGATAATCACCAACGAAATTGGTCACGCAGAATTGTAATCAAGATGAACAAGAGACCGCCACCTGACCCTGTGGCAGTGTTAAGAGGCCATCGTGCTTCTGTCATGGATGTTTGTTTCCATCCTTCTCAAAACTTAGTATTCTCAGGATCTTCAGATGGTGAATTACGAATTTGGGACAATGTCCAACATCGGACTATCTCATCTGCATGGGTACAC...

CDS

Download CDS FASTA

1206 bp · TkA08G112120|TK1151|CDS

AATAGATTAAACCAAAACGAAAAAAGGTCTTCGCTAATCCAAGCAAAACACCCCCTGCCCATTCTGAAGTTCGCATCAAAAGCAAACAAAGCCACCACCGGGGACACCTACGCTACTCAGGCGACCTTCCCTGCTACGACGGCTAGCAAAATTGTAATCAAGATGAACAAGAGACCGCCACCTGACCCTGTGGCAGTGTTAAGAGGCCATCGTGCTTCTGTCATGGATGTTTGTTTCCATCCTTCTCAAAACTTAGTATT...

Protein

Download Protein FASTA

401 aa · TkA08G112120|TK1151|PROTEIN

NRLNQNEKRSSLIQAKHPLPILKFASKANKATTGDTYATQATFPATTASKIVIKMNKRPPPDPVAVLRGHRASVMDVCFHPSQNLVFSGSSDGELRIWDNVQHRTISSAWVHSAAHGIISISTSPSIGNNKVISQGKDGTVKCWDIEHGELSRTPSMSIDANTYHFCKLSLLKKPSDDHVESHPYMAMASSELSQVEVWDLNAAEKFARLPHNSSSPSTNQFTKGKGMCMAIQMFLPPQQQGFLHILTGYEDGTMAWWDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G112120`
TK1151 ID	TkA08G112120
OH-1004 ID	LXL04_026442
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	23.600
Protein coverage (%)	TK1151 81.546 / OH-1004 66.814 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G112120

Location Chr08:29154178-29157152 (-)

Description Similar to DCAF13: DDB1- and CUL4-associated factor 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g29860`	Involved in the formation of X-, Y-shaped and twinned plasmodesmata (PD), thus modelating PD size exclusion limit and regulating cell-to-cell transport.	TANMEI/EMB2757 encodes a WD repeat protein required for embryo development in Arabidopsis.2005 · DOI: 10.1104/pp.105.060467 Plasmodesmata formation and cell-to-cell transport are reduced in decreased size exclusion limit 1 during embryogenesis in Arabidopsis.2012 · DOI: 10.1073/pnas.1202919109

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026442 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0006364 rRNA processing Biological Process

GO:0007056 spindle assembly involved in female meiosis Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0030490 maturation of SSU-rRNA Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0044725 epigenetic programming in the zygotic pronuclei Biological Process

GO:0045995 regulation of embryonic development Biological Process

GO:0051898 negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

KEGG gene cross-reference

gga:420263

hsa:25879

mmu:223499

xtr:407967

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.582

Rank 1 · TkA08G112120 · TK1151

Cytoplasm0.438

Rank 2 · TkA08G112120 · TK1151

Lysosome / Vacuole0.056

Rank 3 · TkA08G112120 · TK1151

Cell membrane0.048

Rank 4 · TkA08G112120 · TK1151

Golgi apparatus0.042

Rank 5 · TkA08G112120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24780WD40_MABP1-WDR62_1st39-105 aa

PF24782WD40_MABP1-WDR62_2nd42-98 aa

PF25173Beta-prop_WDR3_1st45-152 aa

PF08801Nucleoporin_N47-99 aa

PF24817WD40_WDHD1_1st49-109 aa

PF24807WD40_CDC20-Fz49-210 aa

PF23756Beta-prop_HPS552-100 aa

PF23609Beta-prop_EIPR153-98 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G112120	`PF24780`	WD40_MABP1-WDR62_1st	39	105	0.0001	22.4
TkA08G112120	`PF24782`	WD40_MABP1-WDR62_2nd	42	98	3.6e-10	40.1
TkA08G112120	`PF25173`	Beta-prop_WDR3_1st	45	152	2.1e-32	113.1
TkA08G112120	`PF08801`	Nucleoporin_N	47	99	0.00024	20.7
TkA08G112120	`PF24817`	WD40_WDHD1_1st	49	109	1.7e-22	80.6
TkA08G112120	`PF24807`	WD40_CDC20-Fz	49	210	3.3e-20	73.3
TkA08G112120	`PF23756`	Beta-prop_HPS5	52	100	8.3e-05	22.7
TkA08G112120	`PF23609`	Beta-prop_EIPR1	53	98	9.6e-10	39.1
TkA08G112120	`PF24814`	WD40_Prp19	60	153	1.7e-33	116.6
TkA08G112120	`PF25175`	Beta-prop_WDR5	62	299	8.4e-33	114.6
TkA08G112120	`PF23869`	Beta-prop_WDR75_1st	62	338	3.7e-11	43.6
TkA08G112120	`PF23760`	Beta-prop_DCAF12	62	110	3.5e-06	26.9
TkA08G112120	`PF23411`	Beta-prop_Vps41	62	140	1.1e-05	25.6
TkA08G112120	`PF00400`	WD40	63	99	5.6e-28	96.9
TkA08G112120	`PF23215`	WD_LRWD1	63	146	0.0059	16.3
TkA08G112120	`PF25168`	Beta-prop_WDR36-Utp21_2nd	64	125	2.3e-15	57.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3MV14`	Arabidopsis thaliana	sp\|Q3MV14\|DSE1_ARATH Protein DECREASED SIZE EXCLUSION LIMIT 1	55.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card