TkA08G110690 | RubberDandelionOmics

Gene overview

TkA08G110690

Reference: TK1151 Chr: Chr08 Coordinates: 28802574-28803071 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

498 bp · TkA08G110690|TK1151|cDNA

ATGTCGAAAACTTTGTTGCCGGTTGACCAATTCAACCAGATCCGAGACATATTCAACCGGTTCGACATGGACGCTGATGGATCCCTAACCCACCTGGAGCTTGCCGCCCTCCTCCGTTCTCTAGGCCTGAAACCCTCCGGCGACCAAATTGATTTGCTTTTCAACGGCATTGACTCCAATGGCAACGGCGCTGTTGAACTCGATGAATTGGTGCGGGCCATGTTACCAGACATGACGACGGAACAAAACCTCTTCAATCA...

CDS

Download CDS FASTA

498 bp · TkA08G110690|TK1151|CDS

ATGTCGAAAACTTTGTTGCCGGTTGACCAATTCAACCAGATCCGAGACATATTCAACCGGTTCGACATGGACGCTGATGGATCCCTAACCCACCTGGAGCTTGCCGCCCTCCTCCGTTCTCTAGGCCTGAAACCCTCCGGCGACCAAATTGATTTGCTTTTCAACGGCATTGACTCCAATGGCAACGGCGCTGTTGAACTCGATGAATTGGTGCGGGCCATGTTACCAGACATGACGACGGAACAAAACCTCTTCAATCA...

Protein

Download Protein FASTA

165 aa · TkA08G110690|TK1151|PROTEIN

MSKTLLPVDQFNQIRDIFNRFDMDADGSLTHLELAALLRSLGLKPSGDQIDLLFNGIDSNGNGAVELDELVRAMLPDMTTEQNLFNQSKLLKVFRSFDRDGNGVITRAELAKSMAEMGQPLTNRELTEMIEEADTDGDGVISFSEFARVMAKSAAESFGFPVPLP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G110690`
TK1151 ID	TkA08G110690
OH-1004 ID	LXL04_031510
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G110690

Location Chr08:28802574-28803071 (+)

Description Similar to CML16: Probable calcium-binding protein CML16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25600`	Potential calcium sensor.	No verified direct reference in this release
`At1g18530`	Potential calcium sensor.	No verified direct reference in this release
`At3g03000`	Potential calcium sensor that modulates ion selectivity of NHX1.	Vacuolar Na+/H+ antiporter cation selectivity is regulated by calmodulin from within the vacuole in a Ca2+- and pH-dependent manner.2005 · DOI: 10.1073/pnas.0504437102

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0577500`	Potential calcium sensor.	No verified direct reference in this release
`Os01g0505600`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031510 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005509 calcium ion binding Molecular Function

GO:0030234 enzyme regulator activity Molecular Function

KEGG gene cross-reference

ath:AT1G18530

ath:AT1G32250

ath:AT3G25600

dosa:Os01g0604500

dosa:Os05g0577500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.502

Rank 1 · TkA08G110690 · TK1151

Nucleus0.290

Rank 2 · TkA08G110690 · TK1151

Cell membrane0.143

Rank 3 · TkA08G110690 · TK1151

Lysosome / Vacuole0.081

Rank 4 · TkA08G110690 · TK1151

Endoplasmic reticulum0.071

Rank 5 · TkA08G110690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13499EF-hand_711-74 aa

PF21008AIF-111-76 aa

PF25578EF-hand_STIM111-39 aa

PF25825SAPC2_N11-30 aa

PF23564EF-hand_FSTL112-39 aa

PF25325EF-hand_EFHB_C12-24 aa

PF13405EF-hand_613-42 aa

PF13833EF-hand_813-33 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G110690	`PF13499`	EF-hand_7	11	74	4.7e-32	110.9
TkA08G110690	`PF21008`	AIF-1	11	76	4.6e-07	30.9
TkA08G110690	`PF25578`	EF-hand_STIM1	11	39	0.0017	19.1
TkA08G110690	`PF25825`	SAPC2_N	11	30	0.016	15.8
TkA08G110690	`PF23564`	EF-hand_FSTL1	12	39	3.4e-09	37.8
TkA08G110690	`PF25325`	EF-hand_EFHB_C	12	24	0.051	14.1
TkA08G110690	`PF13405`	EF-hand_6	13	42	6.5e-26	88.2
TkA08G110690	`PF13833`	EF-hand_8	13	33	6.1e-24	84.2
TkA08G110690	`PF30624`	EF_SSP120	13	32	0.0012	20.1
TkA08G110690	`PF00036`	EF-hand_1	14	41	6.6e-28	94.9
TkA08G110690	`PF13202`	EF-hand_5	14	37	6e-23	79.9
TkA08G110690	`PF12763`	EH	15	74	0.00017	22.2
TkA08G110690	`PF22592`	FCaBP_EF-hand	16	36	0.00049	21.1
TkA08G110690	`PF10591`	SPARC_Ca_bdg	17	71	6.8e-07	30.3
TkA08G110690	`PF02880`	PGM_PMM_III	17	43	0.0054	17.6
TkA08G110690	`PF14658`	EF-hand_9	18	74	1.1e-09	39.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LI84`	Arabidopsis thaliana	sp\|Q9LI84\|CML16_ARATH Probable calcium-binding protein CML16	58.200%	Swiss-Prot	High
`Q9FZ75`	Arabidopsis thaliana	sp\|Q9FZ75\|CML15_ARATH Probable calcium-binding protein CML15	57.300%	Swiss-Prot	High
`Q9M8U1`	Arabidopsis thaliana	sp\|Q9M8U1\|CML18_ARATH Probable calcium-binding protein CML18	53.200%	Swiss-Prot	High
`Q6L5F4`	Oryza sativa subsp. japonica	sp\|Q6L5F4\|CML14_ORYSJ Probable calcium-binding protein CML14	65.300%	Swiss-Prot	High
`Q9AWK2`	Oryza sativa subsp. japonica	sp\|Q9AWK2\|CML11_ORYSJ Probable calcium-binding protein CML11	50.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card