TkA08G109500 | RubberDandelionOmics

Gene overview

TkA08G109500

Reference: TK1151 Chr: Chr08 Coordinates: 28466853-28468522 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1600 bp · TkA08G109500|TK1151|cDNA

GTTTTTAGAATCTTTACATTTGGACTGGATCACATTAAAAGGTTTTACGCAAAGTGTTGTCTTAAAATCATAAAATGTTCGAATACGCATCTGAAGCCACTTAAACACCAATGACGGGCCAAACCACCTCCGTCGCAACTACCACCTCCGGTAACCCCCAACCGGTCGCCACTTCCTCCCGTCCACAACAACCCCTTCCGCTGATACCAAACCTACCGGACGACGTCGCACTACAATGCATCGCTAGAGTCCCACGGTCC...

CDS

Download CDS FASTA

1131 bp · TkA08G109500|TK1151|CDS

ATGACGGGCCAAACCACCTCCGTCGCAACTACCACCTCCGGTAACCCCCAACCGGTCGCCACTTCCTCCCGTCCACAACAACCCCTTCCGCTGATACCAAACCTACCGGACGACGTCGCACTACAATGCATCGCTAGAGTCCCACGGTCCTACCACCGCTCCCTCTTACCAGTCTCCAAGCTATGGCGATCCACCATACGCTCCCCACACTTCTTCGCCACCCGATCCCTCATCAACTCGACACAACAGTCCCTCTACCT...

Protein

Download Protein FASTA

376 aa · TkA08G109500|TK1151|PROTEIN

MTGQTTSVATTTSGNPQPVATSSRPQQPLPLIPNLPDDVALQCIARVPRSYHRSLLPVSKLWRSTIRSPHFFATRSLINSTQQSLYLNIRHNSSFKWYYHPNPNPTDKCVLSPLPPIPIQPVGPAYAVIGHKIYLIGGSINDIPSTSVWILDCRVNKWEAGPKMRVGREFAAAATVNDKIYVMGGCLVDNRTRSVNWAEVFDPAVGVWCPLPSSSVEAKDKWMHANAVIDGKIYAMADRGGVVYDVAEMLWGRVPKRLDM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G109500`
TK1151 ID	TkA08G109500
OH-1004 ID	LXL04_031486
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 93.085 / OH-1004 96.419 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G109500

Location Chr08:28466853-28468522 (+)

Description Similar to SKIP6: F-box/kelch-repeat protein SKIP6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21950`	F-box/kelch-repeat protein SKIP6.	No verified direct reference in this release
`At4g39590`	F-box/kelch-repeat protein At4g39590.	No verified direct reference in this release
`At4g39240`	F-box/kelch-repeat protein At4g39240.	No verified direct reference in this release
`At4g29370`	F-box/kelch-repeat protein At4g29370.	No verified direct reference in this release
`At4g23580`	F-box/kelch-repeat protein At4g23580.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031486 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT2G21950

ath:AT4G39550

ath:AT4G39580

ath:AT4G39590

ath:AT5G49000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.794

Rank 1 · TkA08G109500 · TK1151

Cytoplasm0.285

Rank 2 · TkA08G109500 · TK1151

Endoplasmic reticulum0.035

Rank 3 · TkA08G109500 · TK1151

Cell membrane0.035

Rank 4 · TkA08G109500 · TK1151

Mitochondrion0.013

Rank 5 · TkA08G109500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box32-72 aa

PF07893DUF166891-135 aa

PF25210Kelch_FKB95106-360 aa

PF13964Beta-prop_Calicin114-240 aa

PF13854Kelch_HCF117-142 aa

PF01344Kelch_1123-164 aa

PF07646Kelch_2123-164 aa

PF24681Kelch_KLHDC2_KLHL20_DRC7123-239 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G109500	`PF00646`	F-box	32	72	1.6e-06	28.5
TkA08G109500	`PF07893`	DUF1668	91	135	0.0058	16.8
TkA08G109500	`PF25210`	Kelch_FKB95	106	360	3.5e-71	240.7
TkA08G109500	`PF13964`	Beta-prop_Calicin	114	240	1.3e-08	34.9
TkA08G109500	`PF13854`	Kelch_HCF	117	142	0.02	14.9
TkA08G109500	`PF01344`	Kelch_1	123	164	1.6e-25	89.0
TkA08G109500	`PF07646`	Kelch_2	123	164	4.6e-13	49.1
TkA08G109500	`PF24681`	Kelch_KLHDC2_KLHL20_DRC7	123	239	2.2e-10	41.0
TkA08G109500	`PF13415`	Beta-prop_FBX42	126	191	2.2e-06	28.2
TkA08G109500	`PF24981`	Beta-prop_ATRN-LZTR1	126	160	0.00022	21.3
TkA08G109500	`PF24996`	NANM	127	235	0.00023	20.8
TkA08G109500	`PF13854`	Kelch_HCF	148	187	0.02	14.9
TkA08G109500	`PF07893`	DUF1668	149	254	0.0058	16.8
TkA08G109500	`PF01344`	Kelch_1	168	213	1.6e-25	89.0
TkA08G109500	`PF07646`	Kelch_2	172	213	4.6e-13	49.1
TkA08G109500	`PF13415`	Beta-prop_FBX42	172	236	2.2e-06	28.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJ04`	Arabidopsis thaliana	sp\|Q9SJ04\|SKIP6_ARATH F-box/kelch-repeat protein SKIP6	49.700%	Swiss-Prot	Medium
`Q1PE10`	Arabidopsis thaliana	sp\|Q1PE10\|FK102_ARATH F-box/kelch-repeat protein At4g39590	35.700%	Swiss-Prot	Medium
`Q9T031`	Arabidopsis thaliana	sp\|Q9T031\|FBK96_ARATH F-box/kelch-repeat protein At4g39240	31.900%	Swiss-Prot	Medium
`Q9M0E6`	Arabidopsis thaliana	sp\|Q9M0E6\|FBK90_ARATH F-box/kelch-repeat protein At4g29370	30.900%	Swiss-Prot	Medium
`Q9SUR8`	Arabidopsis thaliana	sp\|Q9SUR8\|FBK88_ARATH F-box/kelch-repeat protein At4g23580	31.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card