LXL04_031486 | RubberDandelionOmics

Gene overview

LXL04_031486

Reference: OH-1004 Chr: Chr07 Coordinates: 6662036-6663284 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1092 bp · LXL04_031486|LXL04_031486|OH1004|cDNA

ATGACGGGCCAAACCACCTCCGTCGCAACTACCACCTCCGGTAACCCCCAACCGGTCGCCACTTCCTCCCGTCCACAACAACCCCTTCCGCTGATACCAAACCTACCGGACGACGTCGCATTACAATGCATCGCTAGAGTCCCACGGTCCTACCACCGCTCCCTCTTACCAGTCTCCAAGCTATGGCGATCCACCATACGCTCCCCACACTTCTTCGCCACCCGATCCCTCATCAACTCGACACAACAGTCCCTCTACCT...

CDS

Download CDS FASTA

1092 bp · LXL04_031486|LXL04_031486|OH1004|CDS

ATGACGGGCCAAACCACCTCCGTCGCAACTACCACCTCCGGTAACCCCCAACCGGTCGCCACTTCCTCCCGTCCACAACAACCCCTTCCGCTGATACCAAACCTACCGGACGACGTCGCATTACAATGCATCGCTAGAGTCCCACGGTCCTACCACCGCTCCCTCTTACCAGTCTCCAAGCTATGGCGATCCACCATACGCTCCCCACACTTCTTCGCCACCCGATCCCTCATCAACTCGACACAACAGTCCCTCTACCT...

Protein

Download Protein FASTA

363 aa · LXL04_031486|LXL04_031486|OH1004|PROTEIN

MTGQTTSVATTTSGNPQPVATSSRPQQPLPLIPNLPDDVALQCIARVPRSYHRSLLPVSKLWRSTIRSPHFFATRSLINSTQQSLYLNIRHNSSFKWYYHPNPNPTDKCVLSPLPPIPIQPVGPAYAVIGHKIYLIGGSINDIPSTSVWILDCRVNKWEAGPKMRVGREFAAAATVNDKIYVMGGCLVDNRTRSVNWAEVFDPAVGVWCPLPSSSVEAKDKWMHANAVIDGKIYAMADRGGVVYDVAEMLWGRVPKRLDM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031486`
TK1151 ID	TkA08G109500
OH-1004 ID	LXL04_031486
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 93.085 / OH-1004 96.419 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031486

Location Chr07:6662036-6663284 (+)

Description Similar to SKIP6: F-box/kelch-repeat protein SKIP6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21950`	F-box/kelch-repeat protein SKIP6.	No verified direct reference in this release
`At4g39550`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g49000`	F-box/kelch-repeat protein At5g49000.	No verified direct reference in this release
`At4g39590`	F-box/kelch-repeat protein At4g39590.	No verified direct reference in this release
`At4g39580`	F-box/kelch-repeat protein At4g39580.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031486 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT2G21950

ath:AT4G39550

ath:AT4G39580

ath:AT4G39590

ath:AT5G49000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.776

Rank 1 · LXL04_031486 · OH-1004

Cytoplasm0.306

Rank 2 · LXL04_031486 · OH-1004

Endoplasmic reticulum0.037

Rank 3 · LXL04_031486 · OH-1004

Cell membrane0.036

Rank 4 · LXL04_031486 · OH-1004

Mitochondrion0.014

Rank 5 · LXL04_031486 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646.39F-box32-72 aa

PF25210.2Kelch_FKB95106-347 aa

PF13964.13Beta-prop_Calicin114-240 aa

PF01344.32Kelch_1123-164 aa

PF07646.22Kelch_2123-164 aa

PF24681.2Kelch_KLHDC2_KLHL20_DRC7123-237 aa

PF13415.13Beta-prop_FBX42125-191 aa

PF01344.32Kelch_1168-213 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031486	`PF00646.39`	F-box	32	72	1.8e-06	28.4
LXL04_031486	`PF25210.2`	Kelch_FKB95	106	347	3.9e-67	227.4
LXL04_031486	`PF13964.13`	Beta-prop_Calicin	114	240	1.2e-08	35.0
LXL04_031486	`PF01344.32`	Kelch_1	123	164	1.3e-25	89.3
LXL04_031486	`PF07646.22`	Kelch_2	123	164	3.7e-13	49.4
LXL04_031486	`PF24681.2`	Kelch_KLHDC2_KLHL20_DRC7	123	237	1.9e-10	41.1
LXL04_031486	`PF13415.13`	Beta-prop_FBX42	125	191	2e-06	28.3
LXL04_031486	`PF01344.32`	Kelch_1	168	213	1.3e-25	89.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJ04`	Arabidopsis thaliana	F-box/kelch-repeat protein SKIP6	52.478%	Swiss-Prot	strong database homology
`Q9SVA3`	Arabidopsis thaliana	F-box/kelch-repeat protein At4g39550	36.011%	Swiss-Prot	moderate database homology
`Q9FI70`	Arabidopsis thaliana	F-box/kelch-repeat protein At5g49000	36.228%	Swiss-Prot	moderate database homology
`Q1PE10`	Arabidopsis thaliana	F-box/kelch-repeat protein At4g39590	35.905%	Swiss-Prot	moderate database homology
`Q9SVA0`	Arabidopsis thaliana	F-box/kelch-repeat protein At4g39580	32.653%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card