TkA08G108430 | RubberDandelionOmics

Gene overview

TkA08G108430

Reference: TK1151 Chr: Chr08 Coordinates: 28166679-28168150 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1116 bp · TkA08G108430|TK1151|cDNA

ATGGCATATGATATCTTTGATCCAACCGCAAACATAACCATTACATGGGATATTGTTTCATGGACTCCAGATGGCTACGTGGCGGTGGTGAAAATCAACAACTATCAAATGTATCGTCCAATAACGAGTCCCGGATGGACATTCGGATGGACATGGGTCAAGAGTGAAATAATCTGGTCAATGGTAGGGGCTCAAGCGACCGATCAAGGAAACTGCAAGGACTTCCCGAGTAACATTCCTCATTCATGCGAAAAGCATCC...

CDS

Download CDS FASTA

1116 bp · TkA08G108430|TK1151|CDS

ATGGCATATGATATCTTTGATCCAACCGCAAACATAACCATTACATGGGATATTGTTTCATGGACTCCAGATGGCTACGTGGCGGTGGTGAAAATCAACAACTATCAAATGTATCGTCCAATAACGAGTCCCGGATGGACATTCGGATGGACATGGGTCAAGAGTGAAATAATCTGGTCAATGGTAGGGGCTCAAGCGACCGATCAAGGAAACTGCAAGGACTTCCCGAGTAACATTCCTCATTCATGCGAAAAGCATCC...

Protein

Download Protein FASTA

371 aa · TkA08G108430|TK1151|PROTEIN

MAYDIFDPTANITITWDIVSWTPDGYVAVVKINNYQMYRPITSPGWTFGWTWVKSEIIWSMVGAQATDQGNCKDFPSNIPHSCEKHPRIIDMQPDVPYNQQFPNCCKGGIISSMGQDSGNSLSSFQISVGNSGNTYETVSLPKNFTLLGPSRGYTCSPISIVPSSVSLSSGGRRKNRALMSLQLVCGYSQFLASKIPTCCVSMSSFYNSDITPCPSCACGCTDDDNCVNDDSSVSRVLGKSTQREGVIGHVKQCTHHRCP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G108430`
TK1151 ID	TkA08G108430
OH-1004 ID	LXL04_031467
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.200
Protein coverage (%)	TK1151 94.879 / OH-1004 37.785 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G108430

Location Chr08:28166679-28168150 (-)

Description Similar to COBL4: COBRA-like protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g15630`	COBRA-like protein 4.	No verified direct reference in this release
`At5g60920`	Involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XHZ9`	Involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition.	No verified direct reference in this release
`Os03g0416200`	Involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition.	No verified direct reference in this release
`Os07g0604400`	Involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031467 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010215 cellulose microfibril organization Biological Process

GO:0052324 plant-type cell wall cellulose biosynthetic process Biological Process

GO:2001006 regulation of cellulose biosynthetic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0098552 side of membrane Cellular Component

KEGG gene cross-reference

ath:AT5G15630

dosa:Os03g0416200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.319

Rank 1 · TkA08G108430 · TK1151

Cell membrane0.219

Rank 2 · TkA08G108430 · TK1151

Endoplasmic reticulum0.171

Rank 3 · TkA08G108430 · TK1151

Cytoplasm0.140

Rank 4 · TkA08G108430 · TK1151

Lysosome / Vacuole0.112

Rank 5 · TkA08G108430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25079COB_C11-37 aa

PF10008DUF225119-35 aa

PF04833COBRA_N26-189 aa

PF25079COB_C198-335 aa

PF10008DUF2251317-349 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G108430	`PF25079`	COB_C	11	37	2.5e-29	103.5
TkA08G108430	`PF10008`	DUF2251	19	35	0.1	13.0
TkA08G108430	`PF04833`	COBRA_N	26	189	4.2e-55	186.9
TkA08G108430	`PF25079`	COB_C	198	335	2.5e-29	103.5
TkA08G108430	`PF10008`	DUF2251	317	349	0.1	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFW3`	Arabidopsis thaliana	sp\|Q9LFW3\|COBL4_ARATH COBRA-like protein 4	58.500%	Swiss-Prot	High
`Q94KT8`	Arabidopsis thaliana	sp\|Q94KT8\|COBRA_ARATH Protein COBRA	53.500%	Swiss-Prot	High
`A2XHZ9`	Oryza sativa subsp. indica	sp\|A2XHZ9\|COBL5_ORYSI COBRA-like protein 5	53.700%	Swiss-Prot	High
`Q10JL1`	Oryza sativa subsp. japonica	sp\|Q10JL1\|COBL5_ORYSJ COBRA-like protein 5	53.700%	Swiss-Prot	High
`Q6Z4G7`	Oryza sativa subsp. japonica	sp\|Q6Z4G7\|COBL6_ORYSJ COBRA-like protein 6	53.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card