LXL04_031467 | RubberDandelionOmics

Gene overview

LXL04_031467

Reference: OH-1004 Chr: Chr07 Coordinates: 6337736-6343401 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2766 bp · LXL04_031467|LXL04_031467|OH1004|cDNA

ATGGCATATGATATCTTTGATCCAACCGCAAACATAACCATTACATGGGATATTGTTTCATGGACTCCAGATGGCTACGTGGCGGTGGTGAAAATCAACAACTATCAAATGTATCGTCCAATAACGAGTCCCGGATGGACATTCGGATGGACATGGGTCAAGAGTGAAGTAATCTGGTCAATGGTAGGGGCTCAAGCGACCGATCAAGGAAACTGCAAGGACTTCCCGAGTAACATTCCTCATTCATGCGAAAAGCATCC...

CDS

Download CDS FASTA

2766 bp · LXL04_031467|LXL04_031467|OH1004|CDS

ATGGCATATGATATCTTTGATCCAACCGCAAACATAACCATTACATGGGATATTGTTTCATGGACTCCAGATGGCTACGTGGCGGTGGTGAAAATCAACAACTATCAAATGTATCGTCCAATAACGAGTCCCGGATGGACATTCGGATGGACATGGGTCAAGAGTGAAGTAATCTGGTCAATGGTAGGGGCTCAAGCGACCGATCAAGGAAACTGCAAGGACTTCCCGAGTAACATTCCTCATTCATGCGAAAAGCATCC...

Protein

Download Protein FASTA

921 aa · LXL04_031467|LXL04_031467|OH1004|PROTEIN

MAYDIFDPTANITITWDIVSWTPDGYVAVVKINNYQMYRPITSPGWTFGWTWVKSEVIWSMVGAQATDQGNCKDFPSNIPHSCEKHPRIIDMQPGVPYNQQFPNCCKGGIISSMGQDSGNSLSSFQISVGNSGNTYETVSLPKNFTLLGPSRGYTCSPISIVPSSVSLSSGGRRKNRALMSLQLVCGYSQFLASKIPTCCVSMSSFYNSDITPCPSCACGCTDDDNCVNDDSSVSRVLGKSTQREGVIGHVKQCTHHRCP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031467`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031467

Location Chr07:6337736-6343401 (-)

Description Similar to COBL4: COBRA-like protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g15630`	COBRA-like protein 4.	No verified direct reference in this release
`At5g60920`	Involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0416200`	Involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition.	No verified direct reference in this release
`UniProt: A2XHZ9`	Involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition.	No verified direct reference in this release
`Os07g0604400`	Involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031467 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010215 cellulose microfibril organization Biological Process

GO:0052324 plant-type cell wall cellulose biosynthetic process Biological Process

GO:2001006 regulation of cellulose biosynthetic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0098552 side of membrane Cellular Component

KEGG gene cross-reference

ath:AT5G15630

dosa:Os03g0416200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.503

Rank 1 · LXL04_031467 · OH-1004

Extracellular0.186

Rank 2 · LXL04_031467 · OH-1004

Endoplasmic reticulum0.113

Rank 3 · LXL04_031467 · OH-1004

Cytoplasm0.105

Rank 4 · LXL04_031467 · OH-1004

Lysosome / Vacuole0.087

Rank 5 · LXL04_031467 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04833.21COBRA_N26-189 aa

PF25079.2COB_C198-376 aa

PF04833.21COBRA_N530-694 aa

PF25079.2COB_C703-892 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031467	`PF04833.21`	COBRA_N	26	189	2.4e-123	408.9
LXL04_031467	`PF25079.2`	COB_C	198	376	1.3e-84	284.2
LXL04_031467	`PF04833.21`	COBRA_N	530	694	2.4e-123	408.9
LXL04_031467	`PF25079.2`	COB_C	703	892	1.3e-84	284.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFW3`	Arabidopsis thaliana	COBRA-like protein 4	80.048%	Swiss-Prot	weak database homology
`Q94KT8`	Arabidopsis thaliana	Protein COBRA	67.612%	Swiss-Prot	weak database homology
`Q10JL1`	Oryza sativa subsp. japonica	COBRA-like protein 5	70.779%	Swiss-Prot	weak database homology
`A2XHZ9`	Oryza sativa subsp. indica	COBRA-like protein 5	70.779%	Swiss-Prot	weak database homology
`Q6Z4G7`	Oryza sativa subsp. japonica	COBRA-like protein 6	68.287%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card