TkA08G106900 | RubberDandelionOmics

Gene overview

TkA08G106900

Reference: TK1151 Chr: Chr08 Coordinates: 27825411-27827896 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1585 bp · TkA08G106900|TK1151|cDNA

AAAAAAAGCTATTGAAGTTGGCATAAATTTGATTCGTTTCCATTTCCGAATGTTCGATTATTTCGAGGTTTGATTCTTTGGGAATTCTTTGTCCGTGGCTTCAATTCAAATTCTGGTTGCAAATCGTTTAAAAAGGCCCGCATTGAAGAGGCGCGAGTTGGTCTCACGCCCACAACTCATTTTCCTTTACCCGCAACCCTAGGCCACCCATTGCAGATAAGCAACCACCTTCCTATCCGACACTTGTCAATCCTTCAGTA...

CDS

Download CDS FASTA

531 bp · TkA08G106900|TK1151|CDS

ATGACAACTGCTTCTTTGAGCTCCACGACCCTCGTTCAATCACAAATTAATGGGTTCGGCAAGCTTCAAAAACCCGCTATGTTTCAGCCCACTTACACAAGGAAAGCAATTAGAACTGTCGTGAAGGCTTCTCGGGTCGATAAATTCTCCAAGAGCGATATCATTGTATCTCCTTCTATTCTCTCTGCAAACTTCGCCAAATTGGGAGAACAGGTGAAAGCCGTTGAATTGGCAGGTTGTGATTGGATTCATGTTGATGT...

Protein

Download Protein FASTA

176 aa · TkA08G106900|TK1151|PROTEIN

MTTASLSSTTLVQSQINGFGKLQKPAMFQPTYTRKAIRTVVKASRVDKFSKSDIIVSPSILSANFAKLGEQVKAVELAGCDWIHVDVMDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLHRTVNQIKSLGAKCGVVLNPGPLYPP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G106900`
TK1151 ID	TkA08G106900
OH-1004 ID	LXL04_031437
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 97.159 / OH-1004 61.733 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G106900

Location Chr08:27825411-27827896 (+)

Description Similar to RPE: Ribulose-phosphate 3-epimerase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g61410`	Essential protein required during embryogenesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0169100`	Catalyzes the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031437 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006098 pentose-phosphate shunt Biological Process

GO:0009052 pentose-phosphate shunt, non-oxidative branch Biological Process

GO:0009409 response to cold Biological Process

GO:0009624 response to nematode Biological Process

GO:0019253 reductive pentose-phosphate cycle Biological Process

GO:0019323 pentose catabolic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT5G61410

dosa:Os03g0169100

syn:sll0807

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.969

Rank 1 · TkA08G106900 · TK1151

Mitochondrion0.042

Rank 2 · TkA08G106900 · TK1151

Nucleus0.013

Rank 3 · TkA08G106900 · TK1151

Cytoplasm0.011

Rank 4 · TkA08G106900 · TK1151

Cell membrane0.007

Rank 5 · TkA08G106900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00478IMPDH34-91 aa

PF00834Ribul_P_3_epim56-171 aa

PF00478IMPDH124-164 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G106900	`PF00478`	IMPDH	34	91	0.09	12.5
TkA08G106900	`PF00834`	Ribul_P_3_epim	56	171	4.6e-48	164.0
TkA08G106900	`PF00478`	IMPDH	124	164	0.09	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SAU2`	Arabidopsis thaliana	sp\|Q9SAU2\|RPE_ARATH Ribulose-5-phosphate-3-epimerase, chloroplastic	84.000%	Swiss-Prot	High
`Q9ZTP5`	Oryza sativa subsp. japonica	sp\|Q9ZTP5\|RPE_ORYSJ Ribulose-phosphate 3-epimerase, chloroplastic	93.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card