TkA08G106450 | RubberDandelionOmics

Gene overview

TkA08G106450

Reference: TK1151 Chr: Chr08 Coordinates: 27732698-27733288 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

591 bp · TkA08G106450|TK1151|cDNA

ATGAAAGAGAACATCGAGCTTACCTCAGCCGTATCAGCCGGCGTAATAATCATCATGGACCTCAAATTCCTTTCTCTAACGTCGATCAGATATTTCTTGATCTTGTACATGTTAGTAGAGTGGGTAATCTTATTACACGATTGTTATGCTCTGTGGGCAAGACCCATGTGGCGGTTCATCTCCGCCACTCCAACTTCCGTCGGTGAACCACAAGACACGTGCGCAAAGCTTATCCATGGTGGCAGCAAGAAGTCATTAGG...

CDS

Download CDS FASTA

591 bp · TkA08G106450|TK1151|CDS

ATGAAAGAGAACATCGAGCTTACCTCAGCCGTATCAGCCGGCGTAATAATCATCATGGACCTCAAATTCCTTTCTCTAACGTCGATCAGATATTTCTTGATCTTGTACATGTTAGTAGAGTGGGTAATCTTATTACACGATTGTTATGCTCTGTGGGCAAGACCCATGTGGCGGTTCATCTCCGCCACTCCAACTTCCGTCGGTGAACCACAAGACACGTGCGCAAAGCTTATCCATGGTGGCAGCAAGAAGTCATTAGG...

Protein

Download Protein FASTA

196 aa · TkA08G106450|TK1151|PROTEIN

MKENIELTSAVSAGVIIIMDLKFLSLTSIRYFLILYMLVEWVILLHDCYALWARPMWRFISATPTSVGEPQDTCAKLIHGGSKKSLGVDMKVIMKKLGMFWDHDDDKRRIIVSEDILDLFAEEEPSLGEVKEAFGVFDRNNDGYIDVEELQYALSAMGYLTISESDCRRMIDGYDVDKDSKISFREFLKLMEDCFR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G106450`
TK1151 ID	TkA08G106450
OH-1004 ID	LXL04_031432
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G106450

Location Chr08:27732698-27733288 (+)

Description Similar to CML46: Probable calcium-binding protein CML46

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47480`	Potential calcium sensor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0312600`	Potential calcium sensor.	No verified direct reference in this release
`Os11g0586200`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031432 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:1900425 negative regulation of defense response to bacterium Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G05990

ath:AT3G29000

ath:AT3G47480

ath:AT5G39670

dosa:Os04g0492800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.338

Rank 1 · TkA08G106450 · TK1151

Nucleus0.240

Rank 2 · TkA08G106450 · TK1151

Cytoplasm0.216

Rank 3 · TkA08G106450 · TK1151

Cell membrane0.162

Rank 4 · TkA08G106450 · TK1151

Golgi apparatus0.124

Rank 5 · TkA08G106450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13833EF-hand_889-99 aa

PF13499EF-hand_799-108 aa

PF13405EF-hand_6101-106 aa

PF21008AIF-1124-191 aa

PF13833EF-hand_8126-149 aa

PF23564EF-hand_FSTL1128-195 aa

PF00036EF-hand_1129-156 aa

PF13405EF-hand_6129-158 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G106450	`PF13833`	EF-hand_8	89	99	3.5e-09	37.0
TkA08G106450	`PF13499`	EF-hand_7	99	108	4.9e-12	46.7
TkA08G106450	`PF13405`	EF-hand_6	101	106	4e-12	45.4
TkA08G106450	`PF21008`	AIF-1	124	191	0.00063	20.7
TkA08G106450	`PF13833`	EF-hand_8	126	149	3.5e-09	37.0
TkA08G106450	`PF23564`	EF-hand_FSTL1	128	195	0.00025	22.1
TkA08G106450	`PF00036`	EF-hand_1	129	156	1.7e-15	56.0
TkA08G106450	`PF13405`	EF-hand_6	129	158	4e-12	45.4
TkA08G106450	`PF13499`	EF-hand_7	130	191	4.9e-12	46.7
TkA08G106450	`PF13202`	EF-hand_5	131	151	1e-08	35.0
TkA08G106450	`PF24548`	EF_EFCAB10_C	131	164	0.024	15.0
TkA08G106450	`PF14658`	EF-hand_9	132	194	0.0073	17.5
TkA08G106450	`PF10591`	SPARC_Ca_bdg	133	188	0.0097	16.9
TkA08G106450	`PF13833`	EF-hand_8	144	194	3.5e-09	37.0
TkA08G106450	`PF00036`	EF-hand_1	166	192	1.7e-15	56.0
TkA08G106450	`PF13405`	EF-hand_6	168	192	4e-12	45.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SN89`	Arabidopsis thaliana	sp\|Q9SN89\|CML47_ARATH Probable calcium-binding protein CML47	42.400%	Swiss-Prot	Low
`Q0DJ94`	Oryza sativa subsp. japonica	sp\|Q0DJ94\|CML21_ORYSJ Probable calcium-binding protein CML21	44.000%	Swiss-Prot	Low
`Q2R1Z5`	Oryza sativa subsp. japonica	sp\|Q2R1Z5\|CML6_ORYSJ Putative calmodulin-like protein 6	39.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card