LXL04_031432 | RubberDandelionOmics

Gene overview

LXL04_031432

Reference: OH-1004 Chr: Chr07 Coordinates: 5848130-5848720 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

591 bp · LXL04_031432|LXL04_031432|OH1004|cDNA

ATGAAAGAGAACATCGAGCTTACCTCAGCCGTATCAGCCGGCGTAATAATCATCATGGACCTCAAATTCCTTTCTCTAACGTCGTTCAGATATTTCTTGATCTTGTACATGTTAGTAGAGTGGGTAATCTTATTACACGATTGTTATGCTCTGTGGGCAAGACCCATGTGGCGGTTCATCTCCGCCACTCCAACTTCCGTCGGTGAACCACAAGACACGTGCGCAAAGCttatccatggtggcagcaaGAAGTCATTAGG...

CDS

Download CDS FASTA

591 bp · LXL04_031432|LXL04_031432|OH1004|CDS

ATGAAAGAGAACATCGAGCTTACCTCAGCCGTATCAGCCGGCGTAATAATCATCATGGACCTCAAATTCCTTTCTCTAACGTCGTTCAGATATTTCTTGATCTTGTACATGTTAGTAGAGTGGGTAATCTTATTACACGATTGTTATGCTCTGTGGGCAAGACCCATGTGGCGGTTCATCTCCGCCACTCCAACTTCCGTCGGTGAACCACAAGACACGTGCGCAAAGCTTATCCATGGTGGCAGCAAGAAGTCATTAGG...

Protein

Download Protein FASTA

196 aa · LXL04_031432|LXL04_031432|OH1004|PROTEIN

MKENIELTSAVSAGVIIIMDLKFLSLTSFRYFLILYMLVEWVILLHDCYALWARPMWRFISATPTSVGEPQDTCAKLIHGGSKKSLGVDMKVIMKKLGMFWDHDDDKRRIIVSEDILDLFSEEEPSLGEVKEAFGVFDRNNDGYIDVEELQYALSAIGYLRISESDCRRMIDGYDVDKDSKISFREFLKLMEDCFR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031432`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031432

Location Chr07:5848130-5848720 (+)

Description Similar to CML46: Probable calcium-binding protein CML46

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g39670`	Potential calcium sensor.	No verified direct reference in this release
`At3g29000`	Potential calcium sensor.	No verified direct reference in this release
`At3g47480`	Potential calcium sensor.	No verified direct reference in this release
`At1g05990`	Potential calcium sensor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0492800`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031432 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:1900425 negative regulation of defense response to bacterium Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G05990

ath:AT3G29000

ath:AT3G47480

ath:AT5G39670

dosa:Os04g0492800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.344

Rank 1 · LXL04_031432 · OH-1004

Nucleus0.245

Rank 2 · LXL04_031432 · OH-1004

Cytoplasm0.206

Rank 3 · LXL04_031432 · OH-1004

Cell membrane0.155

Rank 4 · LXL04_031432 · OH-1004

Golgi apparatus0.119

Rank 5 · LXL04_031432 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00036.39EF-hand_1129-156 aa

PF13405.13EF-hand_6129-158 aa

PF13499.13EF-hand_7130-191 aa

PF13202.13EF-hand_5131-151 aa

PF13833.13EF-hand_8142-194 aa

PF00036.39EF-hand_1166-192 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031432	`PF00036.39`	EF-hand_1	129	156	1.9e-15	55.9
LXL04_031432	`PF13405.13`	EF-hand_6	129	158	5.9e-12	44.9
LXL04_031432	`PF13499.13`	EF-hand_7	130	191	2.7e-12	47.6
LXL04_031432	`PF13202.13`	EF-hand_5	131	151	1e-08	35.0
LXL04_031432	`PF13833.13`	EF-hand_8	142	194	3.6e-11	43.3
LXL04_031432	`PF00036.39`	EF-hand_1	166	192	1.9e-15	55.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Z27`	Arabidopsis thaliana	Probable calcium-binding protein CML46	43.119%	Swiss-Prot	moderate database homology
`Q9MBG5`	Arabidopsis thaliana	Probable calcium-binding protein CML45	43.519%	Swiss-Prot	moderate database homology
`Q9SN89`	Arabidopsis thaliana	Probable calcium-binding protein CML47	50.000%	Swiss-Prot	weak database homology
`Q9LNE7`	Arabidopsis thaliana	Calmodulin-like protein 7	44.615%	Swiss-Prot	weak database homology
`Q0JC44`	Oryza sativa subsp. japonica	Probable calcium-binding protein CML22	48.485%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card