TkA08G106090 | RubberDandelionOmics

Gene overview

TkA08G106090

Reference: TK1151 Chr: Chr08 Coordinates: 27651924-27655748 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3458 bp · TkA08G106090|TK1151|cDNA

CCACGACCCATAACCGCTTGTGTTTCACATTCAACCTATAAAAACACTGTTATGAGACCAGGGTTTTAAAAAGTTAGGGTTTTTCTGTTCCGCCATAGCGACTGAGAAAGACGATCAATCATTAGTAATGGCCGAAGAAGAAGCAGCAGCAGCCCCCGCGACCACCCTTGCAGAAACAGTAAACGATGAATCACTGACAGCCCCACAAGAGATCGATATGGAAACCACCGATTCCGACGCAGCTGCGGCGGCGGTTAACG...

CDS

Download CDS FASTA

699 bp · TkA08G106090|TK1151|CDS

ATGGCCGAAGAAGAAGCAGCAGCAGCCCCCGCGACCACCCTTGCAGAAACAGTAAACGATGAATCACTGACAGCCCCACAAGAGATCGATATGGAAACCACCGATTCCGACGCAGCTGCGGCGGCGGTTAACGGCGGTAAGCGAGAAAGGGACGAAGAAGTGACCGCCGAAGCTTCGGAAGACGGAAACGGAGCGAAAAAGGCGAAGGTAGATGAGAAGTCTGTAGAAGAACAGAGGCTGGAGAAAGATGCTGCGAAGAG...

Protein

Download Protein FASTA

232 aa · TkA08G106090|TK1151|PROTEIN

MAEEEAAAAPATTLAETVNDESLTAPQEIDMETTDSDAAAAAVNGGKRERDEEVTAEASEDGNGAKKAKVDEKSVEEQRLEKDAAKSGPVTLGHKSFETSVQIFDYFFKFLHFWPPNLNVNKYEHVMLLDLLKKGHTEADKKIGAGINNFQVRYHPQWKSRCFFLVREDETADDFSFRKCVDHILPLPENMAVKSDVNKALGGGGHGGRGGGRGGGRGNWRGRGGGGRGRRN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G106090`
TK1151 ID	TkA08G106090
OH-1004 ID	LXL04_031430
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G106090

Location Chr08:27651924-27655748 (+)

Description Similar to EMB514: Protein EMBRYO DEFECTIVE 514

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62440`	May play a role in ribosome biogenesis and in determining the rate of cell division.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031430 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0017126 nucleologenesis Biological Process

GO:0051302 regulation of cell division Biological Process

GO:1901259 chloroplast rRNA processing Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G45230

ath:AT5G62440

sly:544019

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.833

Rank 1 · TkA08G106090 · TK1151

Cytoplasm0.266

Rank 2 · TkA08G106090 · TK1151

Cell membrane0.041

Rank 3 · TkA08G106090 · TK1151

Endoplasmic reticulum0.035

Rank 4 · TkA08G106090 · TK1151

Mitochondrion0.031

Rank 5 · TkA08G106090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07172GRP44-64 aa

PF11523DUF3223109-181 aa

PF07172GRP202-229 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G106090	`PF07172`	GRP	44	64	4.8	8.6
TkA08G106090	`PF11523`	DUF3223	109	181	2.1e-28	99.4
TkA08G106090	`PF07172`	GRP	202	229	4.8	8.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L557`	Arabidopsis thaliana	sp\|Q8L557\|EM514_ARATH Protein EMBRYO DEFECTIVE 514	78.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card