Gene Card
Gene overview
cDNA / CDS / Protein Sequences
699 bp · LXL04_031430|LXL04_031430|OH1004|cDNA
ATGGCCGAAGAAGAAGCAGCAGCAGCCCCCGCGACCACCCTTGCAGAAACAGTAAACGATGAATCACTGACAGCCCCACAAGAGATCGATATGGAAACCACCGATTCCGACGCAGCTGCGGCGGCGGTTAACGGCGGTAAGCGAGAAAGGGACGAAGAAGTGACCGCCGAAGCTTCGGAAGACGGAAACGGAGCGAAAAAGGCGAAGGTAGATGAGAAGTCTGTAGAAGAACAGAGGCTGGAGAAAGATGCTGCGAAGAG...
699 bp · LXL04_031430|LXL04_031430|OH1004|CDS
ATGGCCGAAGAAGAAGCAGCAGCAGCCCCCGCGACCACCCTTGCAGAAACAGTAAACGATGAATCACTGACAGCCCCACAAGAGATCGATATGGAAACCACCGATTCCGACGCAGCTGCGGCGGCGGTTAACGGCGGTAAGCGAGAAAGGGACGAAGAAGTGACCGCCGAAGCTTCGGAAGACGGAAACGGAGCGAAAAAGGCGAAGGTAGATGAGAAGTCTGTAGAAGAACAGAGGCTGGAGAAAGATGCTGCGAAGAG...
Protein
Download Protein FASTA232 aa · LXL04_031430|LXL04_031430|OH1004|PROTEIN
MAEEEAAAAPATTLAETVNDESLTAPQEIDMETTDSDAAAAAVNGGKRERDEEVTAEASEDGNGAKKAKVDEKSVEEQRLEKDAAKSGPVTLGHKSFETSVQIFDYFFKFLHFWPPNLNVNKYEHVMLLDLLKKGHTEADKKIGAGINNFQVRYHPQWKSRCFFLVREDETADDFSFRKCVDHILPLPENMAVKSDVNKALGGGGHGGRGGGRGGGRGNWRGRGGGGRGRRN
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_031430 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_031430 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:5827483-5828548 (+) | |||||||||
| Description | Similar to EMB514: Protein EMBRYO DEFECTIVE 514 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009658 chloroplast organization Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0017126 nucleologenesis Biological Process GO:0051302 regulation of cell division Biological Process GO:1901259 chloroplast rRNA processing Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0009507 chloroplast Cellular Component GO:0003729 mRNA binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G45230 ath:AT5G62440 sly:544019 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF11523.14DUF3223109-181 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_031430 | PF11523.14 | DUF3223 | 109 | 181 | 2.1e-28 | 99.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.