TkA08G103670 | RubberDandelionOmics

Gene overview

TkA08G103670

Reference: TK1151 Chr: Chr08 Coordinates: 26897639-26898403 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

573 bp · TkA08G103670|TK1151|cDNA

ATGGAAAAACTGGAAGGCAAAGTGGCAATAATCACCGGCGGAGCAAGTGGCATCGGAGAAGTCACCGCCCGTTTGTTCGCCAAACATGGTGCCCGTGCAGTGATCGTAATTGACCTTGATTTTGACCATTTTGACCACCTCTTCGCCGTCAATGTCCGTGGGATGGCGGCGTGTCTGAAGCATGCGGCACGTTCAATGGTGAAGCAGAAGGTGAAAGGAACCATTATTTGCACGGCAAGTGTTGCAGGCAGGCAAGCGGT...

CDS

Download CDS FASTA

573 bp · TkA08G103670|TK1151|CDS

ATGGAAAAACTGGAAGGCAAAGTGGCAATAATCACCGGCGGAGCAAGTGGCATCGGAGAAGTCACCGCCCGTTTGTTCGCCAAACATGGTGCCCGTGCAGTGATCGTAATTGACCTTGATTTTGACCATTTTGACCACCTCTTCGCCGTCAATGTCCGTGGGATGGCGGCGTGTCTGAAGCATGCGGCACGTTCAATGGTGAAGCAGAAGGTGAAAGGAACCATTATTTGCACGGCAAGTGTTGCAGGCAGGCAAGCGGT...

Protein

Download Protein FASTA

190 aa · TkA08G103670|TK1151|PROTEIN

MEKLEGKVAIITGGASGIGEVTARLFAKHGARAVIVIDLDFDHFDHLFAVNVRGMAACLKHAARSMVKQKVKGTIICTASVAGRQAVLQRTDYCMSKHAVIALMKSASKQLGQHGIRVNSVSPFAVATPMTCKMLRKEAAEVEKLFEPMSSLKDVVLKVEDIAEAVLFLAAGESGFITGHDLVVDGGFSV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G103670`
TK1151 ID	TkA08G103670
OH-1004 ID	LXL04_030659
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	44.800
Protein coverage (%)	TK1151 98.421 / OH-1004 91.882 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G103670

Location Chr08:26897639-26898403 (-)

Description Similar to NEPS1: (+)-cis,trans-nepetalactol synthase NEPS1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47140`	Short-chain dehydrogenase reductase 3b.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030659 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016099 monoterpenoid biosynthetic process Biological Process

GO:0031525 menthol biosynthetic process Biological Process

GO:0044283 small molecule biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Molecular Function

GO:0016853 isomerase activity Molecular Function

GO:0018458 isopiperitenol dehydrogenase activity Molecular Function

GO:0018459 carveol dehydrogenase activity Molecular Function

KEGG gene cross-reference

ag:AAU20370

ag:AXF35971

ag:AXF35972

ag:AXF35973

ath:AT2G47140

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.641

Rank 1 · TkA08G103670 · TK1151

Nucleus0.198

Rank 2 · TkA08G103670 · TK1151

Peroxisome0.189

Rank 3 · TkA08G103670 · TK1151

Mitochondrion0.078

Rank 4 · TkA08G103670 · TK1151

Endoplasmic reticulum0.038

Rank 5 · TkA08G103670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02225PA4-38 aa

PF00106adh_short7-36 aa

PF08659KR10-36 aa

PF01370Epimerase10-101 aa

PF13561adh_short_C215-36 aa

PF13561adh_short_C237-189 aa

PF00106adh_short38-135 aa

PF08659KR39-116 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G103670	`PF02225`	PA	4	38	0.51	11.2
TkA08G103670	`PF00106`	adh_short	7	36	2.9e-28	99.4
TkA08G103670	`PF08659`	KR	10	36	0.00053	20.7
TkA08G103670	`PF01370`	Epimerase	10	101	0.0036	17.5
TkA08G103670	`PF13561`	adh_short_C2	15	36	1.5e-40	140.0
TkA08G103670	`PF13561`	adh_short_C2	37	189	1.5e-40	140.0
TkA08G103670	`PF00106`	adh_short	38	135	2.9e-28	99.4
TkA08G103670	`PF08659`	KR	39	116	0.00053	20.7
TkA08G103670	`PF01370`	Epimerase	48	171	0.0036	17.5
TkA08G103670	`PF02225`	PA	74	94	0.51	11.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94K41`	Arabidopsis thaliana	sp\|Q94K41\|SDR3B_ARATH Short-chain dehydrogenase reductase 3b	38.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card