LXL04_030659 | RubberDandelionOmics

Gene overview

LXL04_030659

Reference: OH-1004 Chr: Chr06 Coordinates: 120385814-120386629 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

816 bp · LXL04_030659|LXL04_030659|OH1004|cDNA

ATGGCAGAAGTAAGTGAACAGAGGTTAAAACTCGACCAAAAAGTATCCATAATCACCGGCGGTTCAAGCGGGATCGGAGAAGCAACTGCGCGTCTTTTCGCCAAACACGGCGCACTCGTCGTCATCGCAGACATCGAAGACGAAAAAGGCCAAGAGGTAGCCGCTTCCATCGGCTCAGAACGCTGCACCTACTACCACTGCGACGTCGCCGATGAACAGCAGGTAATCTCCGCCGTTAATTTCACCGTTGCTACATACGG...

CDS

Download CDS FASTA

816 bp · LXL04_030659|LXL04_030659|OH1004|CDS

ATGGCAGAAGTAAGTGAACAGAGGTTAAAACTCGACCAAAAAGTATCCATAATCACCGGCGGTTCAAGCGGGATCGGAGAAGCAACTGCGCGTCTTTTCGCCAAACACGGCGCACTCGTCGTCATCGCAGACATCGAAGACGAAAAAGGCCAAGAGGTAGCCGCTTCCATCGGCTCAGAACGCTGCACCTACTACCACTGCGACGTCGCCGATGAACAGCAGGTAATCTCCGCCGTTAATTTCACCGTTGCTACATACGG...

Protein

Download Protein FASTA

271 aa · LXL04_030659|LXL04_030659|OH1004|PROTEIN

MAEVSEQRLKLDQKVSIITGGSSGIGEATARLFAKHGALVVIADIEDEKGQEVAASIGSERCTYYHCDVADEQQVISAVNFTVATYGRLDIMFSNAGIVSPSTQTVLDLDLTQFDRLYAINARGTAACVKHAALAMVEKHVRGSIICTGSIAASRGGSSRTDYVMAKHAVLGLVRSASKQLGMHGIRVNCVSPSAVVTALSKRSPEATKKTMKVYGALSSLKGVELTVDRVAEAVLFLASESSSFITGLDLVVDGGLTKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030659`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030659

Location Chr06:120385814-120386629 (-)

Description Similar to NEPS1: (+)-cis,trans-nepetalactol synthase NEPS1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47140`	Short-chain dehydrogenase reductase 3b.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030659 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016099 monoterpenoid biosynthetic process Biological Process

GO:0031525 menthol biosynthetic process Biological Process

GO:0044283 small molecule biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Molecular Function

GO:0016853 isomerase activity Molecular Function

GO:0018458 isopiperitenol dehydrogenase activity Molecular Function

GO:0018459 carveol dehydrogenase activity Molecular Function

KEGG gene cross-reference

ag:AAU20370

ag:AXF35971

ag:AXF35972

ag:AXF35973

ath:AT2G47140

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.683

Rank 1 · LXL04_030659 · OH-1004

Nucleus0.270

Rank 2 · LXL04_030659 · OH-1004

Peroxisome0.202

Rank 3 · LXL04_030659 · OH-1004

Mitochondrion0.069

Rank 4 · LXL04_030659 · OH-1004

Lysosome / Vacuole0.034

Rank 5 · LXL04_030659 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106.32adh_short14-206 aa

PF08659.17KR17-189 aa

PF13561.13adh_short_C223-258 aa

PF00155.28Aminotran_1_2167-269 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030659	`PF00106.32`	adh_short	14	206	6.6e-46	157.0
LXL04_030659	`PF08659.17`	KR	17	189	4.7e-09	37.1
LXL04_030659	`PF13561.13`	adh_short_C2	23	258	1e-60	206.0
LXL04_030659	`PF00155.28`	Aminotran_1_2	167	269	7.5e-06	26.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94K41`	Arabidopsis thaliana	Short-chain dehydrogenase reductase 3b	51.779%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card