TkA08G101920 | RubberDandelionOmics

Gene overview

TkA08G101920

Reference: TK1151 Chr: Chr08 Coordinates: 26435161-26436841 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1092 bp · TkA08G101920|TK1151|cDNA

AATAATTTGCAGTGTACTGTGTACGGACACGCCCTTATAAACCCACGCCTCCTTGTTTTTTAAAATCAGCAGTTGTAAGGAGGTTACCATCTATTTGGGTTTTCTATATAAACCACAGTTCTTGCTTCATTATCTCTGAATCCAAGCAACAATGGGGGCGATTTCTATTTTGCACACAGTTTTTGGTATTTTCGGAGATGCAACTGGTCTCTTCCTCTTCCTCGCACCAACGATTACGTTTAAGAGGATAGTGAACAACA...

CDS

Download CDS FASTA

750 bp · TkA08G101920|TK1151|CDS

ATGGGGGCGATTTCTATTTTGCACACAGTTTTTGGTATTTTCGGAGATGCAACTGGTCTCTTCCTCTTCCTCGCACCAACGATTACGTTTAAGAGGATAGTGAACAACAAATCCACTCAACAGTTCTCGGGGATTCCATACCCCATGACCTTGCTCAACTGCCTACTCTCAGCCTGGTATGGATTACCATTCATATCGCAAAACAACACACTGGTGACGGTTATCAACGGTACAGGAGCAGTGATCGAGTCTGTCTACGT...

Protein

Download Protein FASTA

249 aa · TkA08G101920|TK1151|PROTEIN

MGAISILHTVFGIFGDATGLFLFLAPTITFKRIVNNKSTQQFSGIPYPMTLLNCLLSAWYGLPFISQNNTLVTVINGTGAVIESVYVLIFILYAPKKEKAKVLGLLTFVLAAFSTVALVSVFALHGKTRRYFCGFAAAIFSVIMYGSPLSIMTTVIRTKSVEFMPFFLSLFVFLCGTSWFVFGLLGNDPFVYVCNGFGSVLGALQLVLYAIYRKNKGQKDEKLPSENETALEMGFVKPTADQPPDNNGA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G101920`
TK1151 ID	TkA08G101920
OH-1004 ID	LXL04_031334
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.598 / OH-1004 84.932 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G101920

Location Chr08:26435161-26436841 (+)

Description Similar to SWEET1: Bidirectional sugar transporter SWEET1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g21460`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0881300`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release
`UniProt: B8AYH1`	Mediates transport of sugars across the plasma membrane.	No verified direct reference in this release
`Os05g0426000`	Mediates transport of sugars across the plasma membrane.	Plasma membrane-localized hexose transporter OsSWEET1b, affects sugar metabolism and leaf senescence.2024 · DOI: 10.1007/s00299-023-03125-3

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031334 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008643 carbohydrate transport Biological Process

GO:0051260 protein homooligomerization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0042803 protein homodimerization activity Molecular Function

GO:0051119 sugar transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G21460

dosa:Os01g0881300

dosa:Os05g0426000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.763

Rank 1 · TkA08G101920 · TK1151

Cytoplasm0.097

Rank 2 · TkA08G101920 · TK1151

Lysosome / Vacuole0.083

Rank 3 · TkA08G101920 · TK1151

Endoplasmic reticulum0.081

Rank 4 · TkA08G101920 · TK1151

Golgi apparatus0.048

Rank 5 · TkA08G101920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03083MtN3_slv10-97 aa

PF01034Syndecan64-97 aa

PF01034Syndecan102-110 aa

PF03083MtN3_slv133-216 aa

PF02532PsbI178-189 aa

PF01034Syndecan199-221 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G101920	`PF03083`	MtN3_slv	10	97	3.8e-41	139.7
TkA08G101920	`PF01034`	Syndecan	64	97	0.26	12.0
TkA08G101920	`PF01034`	Syndecan	102	110	0.26	12.0
TkA08G101920	`PF03083`	MtN3_slv	133	216	3.8e-41	139.7
TkA08G101920	`PF02532`	PsbI	178	189	4.1	8.2
TkA08G101920	`PF01034`	Syndecan	199	221	0.26	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L9J7`	Arabidopsis thaliana	sp\|Q8L9J7\|SWET1_ARATH Bidirectional sugar transporter SWEET1	74.000%	Swiss-Prot	High
`Q8RZQ8`	Oryza sativa subsp. japonica	sp\|Q8RZQ8\|SWT1A_ORYSJ Bidirectional sugar transporter SWEET1a	59.900%	Swiss-Prot	High
`B8AYH1`	Oryza sativa subsp. indica	sp\|B8AYH1\|SWT1B_ORYSI Bidirectional sugar transporter SWEET1b	62.700%	Swiss-Prot	High
`Q60EC2`	Oryza sativa subsp. japonica	sp\|Q60EC2\|SWT1B_ORYSJ Bidirectional sugar transporter SWEET1b	62.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card